KEGG   Acidaminococcus fermentans: Acfer_0136Help
Entry
Acfer_0136        CDS       T01151                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00520  Amino sugar and nucleotide sugar metabolism
afn01100  Metabolic pathways
afn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Acfer_0136
Enzymes [BR:afn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Acfer_0136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 DUF2564 Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: ADB46544
UniProt: D2RNB8
Position
complement(159167..160300)
Genome map
AA seq 377 aa AA seqDB search
MKAICNGRFILPQEIREGQALVFDERIRGFCSPDRIPPEAERIDVQGAYVSPGFLNLHIH
GCGGRDAMDGSREALETMSRLLPATGVTGWLPTTMTSSETAISQALSAIREARGRVPGAE
ILGANLEGPFISEKYKGAQKACHIRKACWELVEPFAGLIRLLTLAPETLEDMDFISRCRR
AGIIVSLGHSDATWEEAARAVTAGASHITHLYNAMSPLHHRKPGLVGAALTLPVTCELIA
DGIHIHPAALALAIQAKGLDRVELITDSMRACLLGEGKSELGGQTVYVKDGRATLEDGTL
AGSILTMDRAVRNIRSWAHLTLPQAVQLATVNPARELGLTDRGTLEPGKRADITVFDEDF
RILGTYVKGSAVYTTDQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatatgcaacggcagatttattttaccacaagaaatccgggagggacaggca
ctggtgttcgatgaacggatccggggcttctgttccccggaccggatccctccggaagcg
gaacggatcgatgtccagggtgcctatgtgtcaccgggattcctcaaccttcacatccac
ggctgcggaggccgggatgccatggacggcagccgggaagccctggaaaccatgagccgg
ctgctgcccgccaccggggtcaccggctggctccccaccaccatgacctccagtgaaacc
gctatttcccaggctctttccgccatccgggaggcccggggccgggttcccggggcagag
atcctgggggccaacctggaaggccccttcatcagcgaaaaatacaagggtgcccagaaa
gcctgccacatccggaaagcctgctgggagctggtggaaccctttgccggcctgatccgg
ctcctgaccctggccccggagaccctggaggacatggatttcatttcccgctgccgccgg
gccgggatcatcgtttccctggggcacagcgacgccacctgggaagaggctgcccgtgcc
gtgaccgccggtgccagccacatcacccacctgtacaacgccatgagccccctccatcac
cggaagccggggctggtgggggcggccctgaccctgccggtgacctgtgaactgatcgcc
gacgggatccacatccatccggcggccctggccctggccatccaggccaaagggctggac
cgggtggaactgatcaccgattccatgcgggcctgcctcctgggagaaggaaaaagcgag
ctggggggccagaccgtatacgtaaaagacggccgggccaccctggaagacggcaccctg
gccggcagcatcctgaccatggaccgggcggtccggaacatccgcagctgggcccatctg
accctgccccaggccgtccagctggccaccgtcaacccggccagggagctgggcctcacc
gaccggggcaccctggaaccgggcaaacgggcggatatcaccgtgttcgatgaagatttc
cggattttggggacatacgtaaaggggtctgcggtatataccacagaccagtga

DBGET integrated database retrieval system