KEGG   Acidaminococcus fermentans: Acfer_0834Help
Entry
Acfer_0834        CDS       T01151                                 

Definition
(GenBank) 5'-Nucleotidase domain protein
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00230  Purine metabolism
afn00240  Pyrimidine metabolism
afn00760  Nicotinate and nicotinamide metabolism
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Acfer_0834
   00240 Pyrimidine metabolism
    Acfer_0834
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Acfer_0834
Enzymes [BR:afn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Acfer_0834
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     Acfer_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos PGA_cap TetR_C_32
Motif
Other DBs
NCBI-ProteinID: ADB47222
UniProt: D2RJH0
Position
966858..968456
Genome map
AA seq 532 aa AA seqDB search
MLNRKKFLRAGASAALFALLLPLQAWAQVVILHTNDIHCGVDRNLTLARVAAYKKKQKAL
NPQTLLLDAGDAIQGEPLGKLTDGRAMVRILNGAGYDFAIPGNHEFDYGMDNFLSLAKKL
DCGYTSCNFVRLDTGKPVLAPCRIFPFKERKVALIGVTTPGTLVSSTPRFFQDEKGHFIY
GFCEDKAGVKLYRQVQDTVEEAREQGADTVILVAHLGSDGSIPVWSSRALLAHVTGVDGL
IDGHSHEQYEVFYPDRNGKMIPVAQTGTKLQSLGRMVIEDDGTIRGELVRELMEPDPQVE
KLVRKEMAKVDRALSQKVGESSVELVDSLEGQRAVRQKETNLGDFAADAFRTCFKADAAL
INGGSFRSGLPRGAWTRKTLLTLFPFGNQAVLRSISGQQLLDALELSVSHAPEENGGFLQ
VSGLTFVYDPAIPSPVKLDDQGNFARVEGERRVRQVMIGGKPLDPAEDYLVAGTSYILSD
GGNGYTMFRDTTLVAEPGLSDVDILADYVQKQGVSEAYRKPEGQGRIRIDRK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaccgcaagaaattcctgcgggccggcgcttctgccgccctctttgcccttctg
ctgcctctccaggcctgggcccaggtggtgatactccacaccaacgacatccattgcggg
gtggacaggaacctgaccctggcccgggtggcggcttataaaaagaaacagaaagccctg
aatccccagaccctgctcctggacgccggagatgccatccagggggaacccctggggaaa
ctcaccgacggacgggccatggtccggatcctgaatggggcgggctatgattttgccatt
cccggcaaccatgaattcgattacggcatggacaacttcctgtccctggccaaaaaactg
gactgcgggtacaccagctgcaacttcgtccggctggataccgggaaacccgtcctggcc
ccctgccggatctttcccttcaaagaacggaaggtggcgcttatcggggtcaccaccccc
ggtaccctggtgtcgtccacgccccggttcttccaggacgaaaaaggccattttatctat
ggattctgtgaggacaaagcaggggtgaagctttacagacaggtccaggatacggtggag
gaagcacgggaacaaggggcggatacggtgatcctggtggcgcatctgggcagtgacggt
tccatccccgtatggagcagccgggcactcctggcccatgtaaccggcgtggacgggctc
atcgacggccattctcacgaacagtacgaagtgttctatccggaccggaacgggaaaatg
atcccggtggcccagaccggcaccaaactccaaagcctggggcgtatggtcatcgaagat
gacggtaccatccggggcgaactggtccgggagctgatggagccggatccccaggtggag
aaactggtccggaaagaaatggccaaagtggaccgggccctgtcccagaaggtgggagaa
tcctctgtggaactggtggattccctggagggccagcgggccgtgcgccagaaggaaacc
aatctgggggattttgccgcagatgctttccggacctgtttcaaggcggatgcggccctg
atcaacgggggctccttccggtccggtctgccccggggcgcctggacccggaagaccctt
ctgaccctgttcccctttgggaaccaggcggtgctccggagtatttccggccagcagctg
ctggatgccctggaactgagcgtatcccatgcgccggaagaaaacggcgggttcctccag
gtatccgggctgacctttgtctacgatccggccatcccctcaccggtgaaactggatgac
cagggaaatttcgcccgggtggaaggggaacggagggtccgccaggtgatgatcggcggc
aaacccctggatccggcggaagactatctggtggccgggaccagctacatcctcagcgac
gggggcaacggctataccatgttccgggacaccaccctggtagcggaaccgggcctgtcc
gacgtggacatcctggctgattacgtccagaaacagggcgtcagcgaggcctatcggaag
ccggaagggcaggggaggatccggatagacaggaaataa

DBGET integrated database retrieval system