KEGG   Acidaminococcus fermentans: Acfer_1327Help
Entry
Acfer_1327        CDS       T01151                                 

Definition
(GenBank) glutamate synthase (NADPH), homotetrameric
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00250  Alanine, aspartate and glutamate metabolism
afn00910  Nitrogen metabolism
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
afn01120  Microbial metabolism in diverse environments
afn01130  Biosynthesis of antibiotics
afn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Acfer_1327
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acfer_1327
Enzymes [BR:afn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Acfer_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_8 AlaDh_PNT_C Thi4 NAD_binding_7 GIDA FAD_oxidored HI0933_like 2-Hacid_dh_C FAD_binding_3 Oxidored_nitro FAD_binding_2 XdhC_C Fer4_7 NAD_binding_9 Shikimate_DH FMO-like Fer4_11 DAO Amino_oxidase Fer4_18
Motif
Other DBs
NCBI-ProteinID: ADB47688
UniProt: D2RKT6
Position
complement(1466759..1468147)
Genome map
AA seq 462 aa AA seqDB search
MRNPMPEQPADVRNHNFEEVALGYPEDVAVDEAQRCLNCKNPQCVKGCPVNVDIPQFIHA
VTERDFDGAIHILKNKNSLPAVCGRVCPQENQCEKHCILGIKGEPVAIGRLERFVADRAR
EAGTDIVKEGLAPKNGIKVAVVGGGPSCLTAAGDLAKLGYDVTLFEALHKVGGVLMYGIP
EFRLPKAIVQHEIQQLKELGVKIMTDVVIGRTFTLHELLGEEGFQAVYVGTGAGLPHFMR
IPGEALNGVYAANEFLTRVNLMGAWKFPKMATPVYVGKNVAVVGAGNVAMDAARTAKRLG
AENVYVVYRRSEAEMPARKEEIAHAKAEGIELHMLNNPVKILGNEEGWVTGIECVRTELG
EPDASGRRSPVEIPGSNHVFDVDMVVMAIGQGPNPLLKHTTPDLVTNRKGLITVDEKEET
FIPGVFAGGDIVTGAATVISAMGAGKKAAREIDAYLKEKLGK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcccatgccggaacagccggcggatgtacggaaccataactttgaagaagtg
gccctgggctacccggaagacgtggcggtggacgaagcccagcgctgcctcaactgcaag
aatccccagtgcgtcaagggctgcccggtgaacgtggatatcccccagttcatccatgcg
gtgacggaacgggattttgacggagccatccacatcctgaagaacaagaactccctgccc
gctgtgtgcggccgggtgtgcccccaggaaaaccagtgcgaaaaacactgcatcctgggc
atcaagggagaaccggtggccatcggccgtctggaacggttcgtggcggaccgggcccgg
gaagcgggcacggatatcgtgaaagaaggcctggcacccaagaacggcatcaaagtggcc
gtggtggggggcggaccttcctgcctcaccgccgccggggacctggccaaactgggctat
gacgtgacgctgttcgaagccctccacaaggtgggcggggtgctcatgtacggcattccc
gaattccgtctgcccaaggccatcgtccagcacgaaatccagcagctgaaggaactgggc
gtgaagatcatgaccgatgtggtgatcggccgcaccttcaccctccacgaacttctgggc
gaagaaggattccaggccgtgtacgtgggcaccggcgccgggctgccccatttcatgcgg
atccccggagaagccctgaacggggtgtatgccgccaacgaattcctcacccgggtgaac
ctgatgggagcctggaagttcccgaaaatggccacccccgtgtatgtggggaagaacgtg
gccgtagtgggggccggcaacgtggccatggatgccgcccggaccgccaagcggctgggg
gcggaaaacgtctatgtggtgtaccgccggagcgaagcggaaatgcccgcccggaaggaa
gaaatcgcccacgccaaggcggaaggcatcgaactccacatgctgaacaacccggtgaag
atcctgggcaacgaagagggctgggtcaccggcatcgaatgtgtccggacggaactgggc
gaaccggatgcctccggccgccggagcccggtggaaatccccggctccaaccatgtgttt
gacgtggacatggtggtgatggccatcggccaggggcccaaccccctgctgaagcacacc
accccggacctggtgaccaaccggaaagggctcattaccgtggacgaaaaagaagaaacc
ttcattccgggggtctttgccgggggcgatatcgtcaccggggctgcgacggtgatttcc
gccatgggggccggcaagaaggctgcccgggaaatcgacgcctatctgaaagaaaaatta
gggaagtaa

KEGG   Acidaminococcus fermentans: Acfer_2057Help
Entry
Acfer_2057        CDS       T01151                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00250  Alanine, aspartate and glutamate metabolism
afn00910  Nitrogen metabolism
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
afn01120  Microbial metabolism in diverse environments
afn01130  Biosynthesis of antibiotics
afn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Acfer_2057
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acfer_2057
Enzymes [BR:afn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Acfer_2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer4_20 Pyr_redox_3 Pyr_redox NAD_binding_8 HI0933_like 3HCDH_N DAO K_oxygenase Thi4 2-Hacid_dh_C F420_oxidored NAD_Gly3P_dh_N XdhC_C FAD_binding_3 Shikimate_DH NAD_binding_9 FAD_binding_2 FAD_oxidored FMO-like GIDA UDPG_MGDP_dh_N Amino_oxidase DUF5130 PglD_N SIS_2 NAD_binding_2 Lycopene_cycl AlaDh_PNT_C GATase_5 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ADB48402
UniProt: D2RMY4
Position
complement(2287238..2288464)
Genome map
AA seq 408 aa AA seqDB search
MSIHELEEANRCLQCKKPMCREGCPIHTNIPEMIRLFKENDLMTAAQMLFDNNPLSVVCS
LVCNHAAQCEGHCIRGIKGAPVHISAIENYISDSCFDRLKIEQAPSNGKKVAIIGAGPAG
ITIAIILAKRGYQITVFDSRDKIGGIMRYGIPEFRLPRYILDRFEERMKQMGIKFRFNFT
IGGNITLKDLFADGYKSVFIGTGAWRPKRMLIPGETFGNVHYAISYLNNPDAVDLGQSVA
IFGSGNSAMDVARTAVRHGCQNVTVYVRRDHVSASQDEYEYSLLDGVKYEFNKTAVAIKD
EGPMVADTKVEDGHVIVLEDTARLVPVDSVVIAVSQVPKRRLVEHNEGLELNDRGNLKIS
EEGETTLPGVFASGDVVTGAKTVVHAVEYSKKIADEMDLYMKNLEKKG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtccattcacgaattggaagaagccaaccggtgtctccagtgcaagaaacccatgtgc
cgggaaggctgtcccatccataccaatattccggaaatgatccggctgttcaaggaaaac
gacctgatgaccgctgcccagatgctgttcgacaacaacccgctgtccgtggtctgcagt
ctggtatgcaaccatgcagcccagtgcgaagggcattgtatccggggaatcaaaggagct
ccggtacatatttccgctattgagaactacatttctgattcctgcttcgaccggctgaaa
atcgaacaggcaccctccaacgggaaaaaggtagccatcatcggcgccggcccggcgggg
atcaccattgccatcatcctggccaaacggggctaccagatcaccgtgttcgattcccgg
gacaaaatcggggggatcatgcggtacgggatcccggaattccggctgccccggtacatc
ttggaccggtttgaggaacggatgaagcagatggggatcaagttccggttcaacttcacc
atcggcggcaacatcaccctgaaggacctgtttgccgacgggtacaaatccgtgttcatc
ggtaccggggcctggcggcccaaacggatgctgatccccggggaaaccttcggcaacgtc
cattatgccatcagctatctgaacaacccggatgcggtggatctgggccagagcgtggcc
attttcgggtccgggaactccgccatggacgtggcccgtaccgccgtccgtcacggctgc
caaaacgtcaccgtctatgtgcgccgggaccatgtgtccgcctcccaggatgaatacgaa
tattccctgctggacggggtgaagtacgaattcaacaaaaccgccgtggccatcaaggac
gaaggccccatggtggcggataccaaagtggaagacggccatgtgattgtgctggaagac
accgcccggctggtgcccgtggacagtgtggtgatcgccgtttcccaggtgcccaagcgc
cggctggtggaacacaatgaagggctggaactgaacgaccgggggaacctgaagatttcc
gaagaaggggaaaccaccctgcccggggtctttgcctccggagatgtagttaccggggcc
aagaccgtggtccatgccgtggagtattccaagaagattgccgatgaaatggatctttat
atgaaaaacctggaaaaaaagggttga

DBGET integrated database retrieval system