KEGG   Acidaminococcus fermentans: Acfer_1438Help
Entry
Acfer_1438        CDS       T01151                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00450  Selenocompound metabolism
afn00970  Aminoacyl-tRNA biosynthesis
afn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Acfer_1438
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acfer_1438
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:afn01007]
    Acfer_1438
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:afn03016]
    Acfer_1438
Enzymes [BR:afn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Acfer_1438
Amino acid related enzymes [BR:afn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Acfer_1438
Transfer RNA biogenesis [BR:afn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Acfer_1438
 Prokaryotic type
   Other AARSs
    Acfer_1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ABC_transp_aux PseudoU_synth_1
Motif
Other DBs
NCBI-ProteinID: ADB47797
UniProt: D2RL45
Position
complement(1588482..1590434)
Genome map
AA seq 650 aa AA seqDB search
MTKPAFYITTPIYYPSADLHIGHAYCTTIADTIARYKRANGFDVQFITGSDEHGLKIQRK
AESFGVKPIEYTDKIVADFKKLWEMLGVSYTSFVRTSSPEHEKTVQTLLQKVWEQGDIYK
KDYEGLYCVPCESFWTEHQVEEAGGVCPDCGRPVEKMRESSYFFRMSKYADRILEYIETH
PDFIQPVSRRNEMINFIKQGLEDLCISRSSFDWGIQVPFDPKHVVYVWFDALLAYFTGIG
FGRDMDKFNRFWPADLHLVGKEIVRFHTIIWPAMLMAMGFDLPKEVYGHGWLVVDGDKMS
KSKGNVVDPVQPIQEFGADAVRYFLLREINLGSDGNYSRKGLIKRFNSDLANDLGNLQYR
TVSMIDKYHGGIVHKTVVESETDEKFRSLAAETLQNYRAAMDKYALNDGIKAIWAYVGAA
NKYIDETTPWILAKDPAQAKRLEAVMYNLADAVRNIAILISSMMPFTAPKIFEQLGLTVP
EQFNLNDVAWGNFPDGTKVAKGQPIFPRIEEEEEDKPAEAKKEAKPAKKEKKADKRNAGV
VTPDQCTIEDFGKLDLRVGTILSAEKMPNADKLLKIQVQVGDETRTIVSGIAPYYKEEEL
TGKNVIVIANLKPAKLRGVESRGMLLAASDGQGNLKLAEVPGIASGSKVK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacctgctttttatattacgacgcccatttactatcccagcgccgacctgcac
atcggacacgcctactgcaccaccattgccgataccatcgcccggtacaaacgggccaac
ggctttgatgtccagttcatcaccggcagcgacgaacacggcctgaagatccagcggaaa
gcggaatccttcggggtgaagcccatcgaatacaccgacaagatcgtggcggacttcaag
aagctgtgggagatgctgggggtcagctacacctccttcgtccgcacttccagcccggaa
cacgaaaagaccgtccagaccctgctccagaaagtctgggaacagggggacatctacaaa
aaggactatgaaggcctgtactgcgtgccctgcgaatccttctggaccgaacaccaggtg
gaggaagccgggggcgtgtgcccggactgcggccgtcctgtggaaaagatgcgggaaagc
agctatttcttccggatgtccaaatatgcggaccggatcttggaatacattgagacccat
ccggatttcatccagcccgtatcccgccggaacgaaatgatcaacttcatcaaacagggg
ctggaagacctgtgcatcagccggagcagcttcgactggggcatccaggtgcccttcgat
cccaaacacgtggtgtacgtgtggttcgatgccctgctggcctacttcaccggcatcggc
ttcggccgggatatggacaagttcaaccggttctggccggcggacctccacctggtgggg
aaggaaatcgtccggttccataccatcatctggccggccatgctgatggccatgggcttc
gacctgcccaaggaagtgtacggccacggctggctggtggtggacggggacaaaatgtcc
aaatccaagggcaatgtggtggatccggtgcagcccatccaggaattcggggctgatgcc
gtccgctatttcctgctccgggaaatcaacctgggcagcgacgggaactattcccggaag
ggcctgatcaagcggttcaactccgatctggccaacgacctggggaacctccagtaccgg
accgtttccatgatcgacaaataccacgggggcatcgtccacaagaccgtggtggaaagc
gaaaccgatgagaagttccgcagcctggccgccgaaaccctgcagaactaccgggccgct
atggacaaatacgccctgaacgacgggatcaaggccatctgggcctatgtgggggccgcc
aacaagtacatcgacgaaaccacgccctggatcctggccaaggatccggcccaggccaaa
cggctggaagcggtgatgtacaacctggccgatgcggtccggaacatcgccatcctgatt
tcctccatgatgcccttcaccgcgcccaagatcttcgagcagctgggtctcaccgtaccg
gaacagttcaatctgaacgacgtggcctggggcaatttccccgacggcaccaaagtggcc
aagggccagcccatcttcccccggatcgaggaagaagaggaagacaagccggcagaagcc
aagaaggaagccaaaccggccaaaaaggaaaagaaagccgacaaaagaaacgccggcgtg
gtgaccccggaccagtgcaccatcgaagatttcggcaagctggacctgcgggtgggcacc
atcctcagcgcggaaaagatgcccaacgcggacaagctgctgaagatccaggtgcaggtg
ggggacgaaacccgcaccatcgtatccggcatcgctccctactataaggaagaggagctc
accggcaaaaacgtgatcgtcattgccaacctgaagcccgccaagctccggggtgtggaa
tccagagggatgctcctggccgcttcagacgggcaggggaacctgaaactggcggaagtg
ccggggatcgcctccggcagcaaggtgaaataa

DBGET integrated database retrieval system