KEGG   Acidaminococcus fermentans: Acfer_1478Help
Entry
Acfer_1478        CDS       T01151                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00071  Fatty acid degradation
afn00280  Valine, leucine and isoleucine degradation
afn00310  Lysine degradation
afn00362  Benzoate degradation
afn00380  Tryptophan metabolism
afn00620  Pyruvate metabolism
afn00630  Glyoxylate and dicarboxylate metabolism
afn00640  Propanoate metabolism
afn00650  Butanoate metabolism
afn00900  Terpenoid backbone biosynthesis
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
afn01120  Microbial metabolism in diverse environments
afn01130  Biosynthesis of antibiotics
afn01200  Carbon metabolism
afn01212  Fatty acid metabolism
afn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:afn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acfer_1478
   00630 Glyoxylate and dicarboxylate metabolism
    Acfer_1478
   00640 Propanoate metabolism
    Acfer_1478
   00650 Butanoate metabolism
    Acfer_1478
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Acfer_1478
   00072 Synthesis and degradation of ketone bodies
    Acfer_1478
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Acfer_1478
   00310 Lysine degradation
    Acfer_1478
   00380 Tryptophan metabolism
    Acfer_1478
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acfer_1478
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Acfer_1478
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Acfer_1478
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afn04147]
    Acfer_1478
Enzymes [BR:afn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Acfer_1478
Exosome [BR:afn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acfer_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD Pro-kuma_activ
Motif
Other DBs
NCBI-ProteinID: ADB47837
UniProt: D2RL85
Position
complement(1636901..1638082)
Genome map
AA seq 393 aa AA seqDB search
MREVVIVSAVRTAIGKFGGSLTPLSAPQMGAIVIKEALNRAGVKPELVDEVIMGNVLQAG
LGQNPARQAAIFAGMPVEVPAFTVNKVCGSGLKCVELAAQSILAGDNDIVVAGGMESMSN
APFTVPGKARWGLKMGDQKMIDVMIRDGLWDAFNDYHMGITSENVAEKFGVTREDQDEVA
ARSQARAIEAIKSGAFKEEIVPVTIKTKKGEKVFDTDEFPREGTTMEVLAKLRPAFKKGG
TVTAGNASGLNDGAAALVLMTAEKAAELGLKPMAKIVSYASAGVDPAIMGIGPIPASRKA
LAKAGLEVKDLDLVEANEAFAAQTVEVGRELQLDWDKTNVNGGAIALGHPIGASGARILV
TLLYALKHRNKKLGLATLCIGGGMGTATVVEML
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagttgttattgtaagtgctgtaagaacggcaatcggtaagttcggcggaagc
ctgaccccgctgtccgctcctcagatgggcgccatcgtcatcaaggaagccctgaacaga
gccggtgtgaaaccggaactggtggatgaagtgatcatggggaacgtgctccaggccggc
ctgggccagaaccctgcccgtcaggctgccatttttgccggcatgccggtggaagtccct
gccttcaccgtcaacaaagtctgcggttccggactgaaatgcgtggaactggctgcccag
tccatcctggccggagataacgacatcgttgtggccggcggcatggaaagcatgtccaac
gctccctttaccgtaccggggaaagcccgctggggcctgaagatgggcgatcagaaaatg
atcgacgtaatgatccgtgacggtctgtgggatgctttcaacgactaccacatgggcatc
acctctgaaaacgtggcggaaaaattcggcgtaacccgggaagaccaggacgaagtggct
gcccgttcccaggcaagagccattgaagccatcaagagcggcgctttcaaggaagaaatc
gtccctgttaccattaaaaccaaaaaaggcgaaaaagtcttcgataccgatgaattcccc
agagaaggaacaaccatggaagtcctggccaaactgcgcccggccttcaagaagggcggc
accgttaccgccggcaacgcttccggcctgaacgacggggctgccgctctggtcctgatg
accgctgaaaaagccgcagaactgggcctgaaacccatggccaagatcgtttcctacgct
tctgctggtgtggatcccgccatcatgggcatcggacccatccctgccagccggaaggct
ctggccaaagccggtctggaagtgaaggatctggatctggtggaagccaacgaagctttc
gcagcccagaccgtagaagtgggccgggaactgcagctggattgggacaagaccaacgtg
aacggcggtgccatcgccctgggtcaccccatcggtgcttccggtgcccgtatcctggtc
accctgctgtatgcgctgaaacacagaaataagaaactgggcctggccaccctgtgcatc
ggcggcggcatgggcacggccactgttgtggaaatgctctaa

DBGET integrated database retrieval system