KEGG   Acidaminococcus fermentans: Acfer_1597Help
Entry
Acfer_1597        CDS       T01151                                 

Definition
(GenBank) hypoxanthine phosphoribosyltransferase
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00230  Purine metabolism
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Acfer_1597
Enzymes [BR:afn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     Acfer_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran PRTase_2
Motif
Other DBs
NCBI-ProteinID: ADB47954
UniProt: D2RLK2
Position
complement(1764384..1764923)
Genome map
AA seq 179 aa AA seqDB search
MNENLERILIDEKTLKARIAEMGAQISRDYAGEELVVIGLLKGAAYFLTELTQHITVPVR
IDFIKASSYGSGTTTSGKVDIDYDTSRNIAGKNVLLVDDVIDTGLTLKAVGELFRNRNPK
SLKVAAMLDKKERRLVKVLPDYAGFEIPDEFVVGFGLDYDEEYRNLPYIGIMKRSVYEK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaatcttgaaagaatcctcatcgatgagaaaaccctgaaagcccgcattgca
gaaatgggcgcccaaatcagccgggattacgccggagaagaactggtggtcatcggcctt
ttgaaaggggccgcctacttcctgacggaactgacccagcatatcaccgtgccggtacgg
atcgacttcatcaaggcctcttcctatggttccggcaccacgacttccggcaaggtggac
attgattatgacacttcccggaacatcgccgggaaaaacgtcctgctggtggacgatgta
atcgacaccggcctgaccctgaaagccgtgggagaactgttccggaaccggaaccccaag
agcctgaaggtggccgccatgctggacaagaaggaacgccgtctggtaaaggtgctgccg
gattacgccgggttcgagatccccgatgaattcgtggtgggctttggcctggactatgat
gaagaataccggaatctgccctatatcggcattatgaagcgttccgtctatgaaaaataa

KEGG   Acidaminococcus fermentans: Acfer_2090Help
Entry
Acfer_2090        CDS       T01151                                 

Definition
(GenBank) xanthine phosphoribosyltransferase
  KO
K03816  xanthine phosphoribosyltransferase [EC:2.4.2.22]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00230  Purine metabolism
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Acfer_2090
Enzymes [BR:afn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.22  xanthine phosphoribosyltransferase
     Acfer_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran DUF4127
Motif
Other DBs
NCBI-ProteinID: ADB48434
UniProt: D2RN16
Position
complement(2322585..2323169)
Genome map
AA seq 194 aa AA seqDB search
MAEYNLLQKKILADGTIKSGDVLKVDSFLNHQIDVPFISKLGKEFYELFKDRPISKILTI
EASGIGIACLTAVHFRVPVLFAKKSAGSNMDKDVYSTEIRSFTHNKVNHVVVSKKYLNAG
DHVLIIDDFLANGCAVEGLIDLVHQAGAEVEGVGIAIEKGFQGGGDALRKKGYDVKSLAI
IEKMDAASGTIVFR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtacaatttactgcagaagaaaatcctggcggacgggaccattaaaagcggc
gatgtgttgaaggtggacagtttcctgaaccaccagatcgatgtgcctttcatcagcaag
ctggggaaggaattctacgaactgttcaaggaccggcccatcagcaagatcctgaccatc
gaggcttccggcatcggcattgcctgtctgacggcggtccatttccgggtgcccgtgctc
tttgccaagaaaagcgccggcagcaacatggacaaggacgtctacagcacggaaatcaga
tccttcacccacaacaaggtgaaccatgtagtggtttccaagaaatacctgaatgccgga
gatcacgtactgatcatcgatgacttcctggccaacggctgtgcggtggaaggccttatc
gacctggtccaccaggctggtgccgaagtggaaggagtgggcattgccatcgaaaaaggc
ttccaggggggcggcgatgccctgcggaagaaaggctacgatgtaaagagcctggccatc
attgaaaaaatggatgccgcatccggcaccatcgtattccggtaa

DBGET integrated database retrieval system