KEGG   Acidaminococcus fermentans: Acfer_1796Help
Entry
Acfer_1796        CDS       T01151                                 

Definition
(GenBank) serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00270  Cysteine and methionine metabolism
afn00920  Sulfur metabolism
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
afn01120  Microbial metabolism in diverse environments
afn01200  Carbon metabolism
afn01230  Biosynthesis of amino acids
Module
afn_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:afn00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Acfer_1796
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Acfer_1796
Enzymes [BR:afn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     Acfer_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep SATase_N FlxA SlyX
Motif
Other DBs
NCBI-ProteinID: ADB48150
UniProt: D2RM48
Position
1991859..1992557
Genome map
AA seq 232 aa AA seqDB search
MFASMRNDIRVIKQRDPAVKNTLEVVLCYSGLHAIWAYRLSHFFYKKSWFVTARFISTLA
RLATGIEIHPGAQIGEGLFIDHGSGIVIGETTIIGNNVSLYQGVTLGGTGKEKGKRHPTI
GDYVVVACGAKVLGSFTVGEGAKIGAGSVVLKEVPPYATVVGIPGHVVARKGIRVAPAHS
ERDVDLNHNRLPDPIEDQIAALEKQVALLKRQVSDLRAQQEGPALKQVVNFR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatccatgcgcaatgatatccgggttatcaaacaacgggatccggcggtgaag
aacaccctggaagttgtgctctgttactcgggtctccacgccatctgggcctaccggctt
tcccatttcttctataaaaagtcctggttcgttaccgcccgtttcatttccaccctggcc
cggctggccacaggcatcgagatccatcccggtgcccagatcggagaagggctgttcatc
gaccacgggtccggcatcgtcatcggagaaaccaccatcatcggcaacaatgtttccctg
taccagggagtgaccctgggcggcaccggcaaggaaaaaggcaaacggcatcccaccatc
ggagactatgtggtggtggcctgcggagccaaggtgctgggttccttcaccgtgggagaa
ggggccaagatcggggccggcagcgtggtgctgaaagaagtgcctccctatgccacagta
gtgggcattcccggccatgtggtggcccggaaaggtatccgggtggctcccgcccattcc
gaacgggatgtggacctgaaccacaaccggctgcctgaccccatcgaggaccagattgcc
gccctggaaaaacaggtggccctgctgaaacggcaggtcagtgacctgcgggcccagcag
gaaggcccggccctgaagcaggtggtcaacttccgctga

DBGET integrated database retrieval system