KEGG   Acidaminococcus fermentans: Acfer_1888Help
Entry
Acfer_1888        CDS       T01151                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00330  Arginine and proline metabolism
afn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Acfer_1888
Enzymes [BR:afn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Acfer_1888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADB48240
UniProt: D2RMD8
Position
complement(2105951..2106805)
Genome map
AA seq 284 aa AA seqDB search
MLKNNVETFLACDAPYEDAKIVLFGAPFDSTTSFRPGTRFGSSAIRHESFGLETYSPYQD
KDLEEYAVFDSGDLELCFGSSEMALQDIEERTATILQDGKLPFMVGGEHLVTLGAFRAVL
KKYPDVQIIHFDAHTDLRDDYLGVKLSHACVIRRCHDLIGDGKIHQFCIRSGEKAEWQFA
RQHTDLHPFSFGGLEQLVRNLEKSQVPVYFTIDLDCLDPSVFPGTGTPEAGGVTFMALLN
ALRLVARTNVVAADVNELAPMLDASGASTAVACKVVRELLLALL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaataacgtggaaaccttcctggcctgtgatgctccctatgaggacgccaaa
atcgtcctgttcggggcgccctttgattccaccaccagcttccggcccgggacccggttc
gggtcttctgccatccgccacgaaagcttcgggctggaaacttacagcccctaccaggac
aaggatctggaagagtacgccgtttttgacagcggggatctggaactgtgcttcggcagt
tcggaaatggccctccaggacattgaggaacggacggccaccatcctccaggacgggaaa
ctgcctttcatggtggggggcgagcacctggtgaccctgggggctttccgggcagtgctg
aaaaagtacccggatgtccagatcatccacttcgatgcccacacggacctgcgggacgat
tacctgggggtcaaactgagccatgcctgcgtaatccgccggtgccacgacctgatcggg
gacggaaagatccatcagttctgcatccgcagcggggaaaaggcggaatggcagttcgcc
cggcagcacacggacctgcatcccttcagcttcggagggctggaacagctggtccggaat
ctggaaaagagtcaggttccggtgtacttcaccatcgacctggactgcctggatccttcg
gtgttcccggggaccggtaccccggaagccgggggcgtcaccttcatggcgctgctgaac
gccctgcggctggtggcccggacaaatgtggtggccgccgacgtgaacgaactggcaccc
atgctggatgccagcggcgcctccaccgccgtggcctgcaaagtggtccgggaactgctg
ctggcgctgttgtaa

DBGET integrated database retrieval system