KEGG   Acidimicrobium ferrooxidans: Afer_0851Help
Entry
Afer_0851         CDS       T00956                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00010  Glycolysis / Gluconeogenesis
afo00051  Fructose and mannose metabolism
afo00562  Inositol phosphate metabolism
afo00710  Carbon fixation in photosynthetic organisms
afo01100  Metabolic pathways
afo01110  Biosynthesis of secondary metabolites
afo01120  Microbial metabolism in diverse environments
afo01130  Biosynthesis of antibiotics
afo01200  Carbon metabolism
afo01230  Biosynthesis of amino acids
Module
afo_M00002  Glycolysis, core module involving three-carbon compounds
afo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Afer_0851
   00051 Fructose and mannose metabolism
    Afer_0851
   00562 Inositol phosphate metabolism
    Afer_0851
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Afer_0851
Enzymes [BR:afo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Afer_0851
Exosome [BR:afo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Afer_0851
  Exosomal proteins of bladder cancer cells
   Afer_0851
  Exosomal proteins of melanoma cells
   Afer_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACU53797
UniProt: C7LYI9
Position
873338..874165
Genome map
AA seq 275 aa AA seqDB search
MSRRAPEPEPQAGSGRVRLVVANWKLHHTHLEAIAFLERLWHLLDVEDYRRAEIAICPAF
TALRSAQLTIETDGMPYRLGAQDVFWEPSGAYTGEVSVPMLAKLDVKYVIVGHSERRRLF
GETDDVVAKKAAAVASGGLVPIVCVGEVAEERAGGTTEAVLERQLDTVLTTYPVEALGEL
VIAYEPVWAIGSGTPATPEDAEHVARFLRDRLARRASEAVAARVRILYGGSVDVGNAVAF
LAQADIDGLLVGGASLDPERFAQLLGGRPRIASTS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggcgggctcccgagcccgagccccaggcgggatccggacgggtgcgtctcgtc
gtcgccaactggaagctgcaccacacgcacctcgaagccatcgcgttcttggagcggctg
tggcacctgttggatgtcgaggactaccggcgcgcggagatcgcgatctgccctgcattc
acggcgctgcggtcggcgcagctgacgatcgagaccgatggcatgccctatcggctcggt
gcccaagacgtcttctgggaaccctcgggggcctacacgggggaggtgagcgtccccatg
ctcgccaagctggacgtcaagtacgtgatcgtggggcactctgagcgccggcgcttgttc
ggcgagaccgacgacgtggtcgccaagaaggcggcggcggtcgcgtccggtgggttggta
ccgatcgtgtgcgtgggtgaggtcgccgaagagcgcgctgggggtaccacggaggccgtg
ctcgagcgccaactcgacacggtgctcacgacgtatccggtcgaggcgctcggagagctc
gtgatcgcctacgaacccgtctgggcgatcggttcgggaacgcccgcgacgcccgaagac
gccgagcacgtcgctcgcttcctccgggaccgcctcgcgcgccgggcgagcgaggcggtg
gctgctcgcgtccgcatcctctacggtggctccgtcgacgtgggcaatgcggtcgcgttc
ctcgcgcaggccgacatcgatggtctcctcgtcgggggtgcctcgctcgatccggagcgt
ttcgcgcagctgctcggcggccgaccccgcatcgcgtcgacgtcctag

DBGET integrated database retrieval system