KEGG   Acidimicrobium ferrooxidans: Afer_1881Help
Entry
Afer_1881         CDS       T00956                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00020  Citrate cycle (TCA cycle)
afo00480  Glutathione metabolism
afo01100  Metabolic pathways
afo01110  Biosynthesis of secondary metabolites
afo01120  Microbial metabolism in diverse environments
afo01200  Carbon metabolism
afo01210  2-Oxocarboxylic acid metabolism
afo01230  Biosynthesis of amino acids
Module
afo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:afo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Afer_1881
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Afer_1881
Enzymes [BR:afo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Afer_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACU54792
UniProt: C7M1P5
Position
complement(1967432..1968655)
Genome map
AA seq 407 aa AA seqDB search
MATPVRMGADGRLIVGDEVIIPYIEGDGTGVDIWPAARTVFDAALAAHGRRVEWREVLAG
EKAFRETGSWLPDETLSVFREYLVGIKGPLTTPVGGGIRSLNVALRQLLDLYVCLRPVRW
FEGVPSPVRHPEWVDMVIFRENTEDVYAGLEVQAGSEEARALREFLAERFGWELGADAGI
GIKPVSAHGSKRLIRAAIRYALDHHRRSVTLVHKGNIQKFTEGAFRAWGYELVREEFADV
AVGWDDCGGDPGDKLLVKDAIADNAFQQVLTRPRDYDVIATTNLNGDYLSDALAAQVGGI
GIAPGGNINYVTGHGIFEATHGTAPKYAGKDMVNPGSVILSGVLMFEYLGWNDVADAIVD
ALERTIAEGIVTYDFARLRDGATKVSTSEFGHAVAERIRRGDEKTGG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtggcaactccggtgcgcatgggagccgacggtcggctgatcgtcggcgatgaggtcatc
atcccctacatcgagggcgatggaaccggggtggacatctggcccgccgcgaggacggtc
ttcgatgcggcactcgcggcccatgggcgtcgcgtcgagtggcgcgaggtgctcgctggc
gagaaggccttccgcgagaccgggtcgtggctgccggacgagacgctgtcggtgtttcgt
gagtatctcgtcgggatcaagggcccgctcacgaccccggtcggtggcggcatccgttcg
ctgaacgtcgccctgcgtcagctgctcgatctctacgtctgcctgcggcccgtgcgctgg
ttcgagggcgtgccgtcgccggtgcgccatccggagtgggtggacatggtgatctttcgc
gagaacaccgaggacgtctacgctggcctcgaggtccaggctggttcggaggaggcccgt
gcgctgcgcgagttcctcgccgagcgcttcgggtgggagctcggcgccgatgcagggatc
gggatcaagcccgtgtcggcccatgggtccaagcggctcatccgagctgccattcgctac
gccctcgatcaccaccgccgctcggtgacgctcgtccacaagggcaacatccagaagttc
accgagggtgcgttccgtgcgtgggggtacgagctcgtgcgtgaggagttcgcggacgtc
gccgttggctgggacgactgtggtggtgatcccggcgacaagctgctcgtcaaggatgcg
atcgccgacaacgccttccagcaggtgctcacgcggcctcgggactacgacgtcatcgcg
acgacgaacctgaacggcgattacctctcggacgcgctggccgcccaggtcggaggcatc
ggcatcgcaccgggcggcaacatcaactacgtcaccggtcacgggatcttcgaggcgacc
catggtacggccccgaagtatgccggcaaggacatggtgaatccgggttcggtcatcctg
tccggcgtgctgatgttcgagtacctgggctggaatgacgtcgccgacgccatcgtcgat
gcgctcgagcggaccatcgccgagggcatcgtgacctacgacttcgcacggttgcgcgat
ggcgcgaccaaggtctcgaccagcgagttcggccacgccgtcgcggagcgcattcgtcgg
ggggacgagaagacggggggatga

DBGET integrated database retrieval system