KEGG   Alcaligenes faecalis JQ135: AFA_01380Help
Entry
AFA_01380         CDS       T05446                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
afq  Alcaligenes faecalis JQ135
Brite
KEGG Orthology (KO) [BR:afq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AFA_01380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 CARDB DUF4354
Motif
Other DBs
NCBI-ProteinID: ASR88214
Position
304699..305073
Genome map
AA seq 124 aa AA seqDB search
MKPDDIEVQITPQYLPEQSEPESNQYVFAYTVRITNNGQQTAQIISRHWIITDDNQQVQE
VRGLGVVGQQPVLAPGETFEYTSGCPLNTPFGTMRGSYQCVGENGVPFEVLIQEFILSSP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgacgatattgaggtgcaaatcacgccccagtacctgcctgagcaatccgag
cccgagagtaaccaatacgtgtttgcctataccgtacggattaccaacaatggacagcag
acggcccagattatcagtcgtcactggatcattacggacgacaatcagcaggttcaggaa
gtgcgtggcctgggtgttgtgggacaacagccggtgctcgctcccggcgagaccttcgag
tacaccagtggctgtcccttaaatacaccgtttggcaccatgcgtggcagctatcaatgt
gtaggtgaaaatggtgtgccctttgaggtcctcatccaggagttcatcctttcctccccc
cgtaccttgcactaa

DBGET integrated database retrieval system