KEGG   Alcaligenes faecalis JQ135: AFA_02595Help
Entry
AFA_02595         CDS       T05446                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
afq  Alcaligenes faecalis JQ135
Pathway
afq00670  One carbon pool by folate
afq00790  Folate biosynthesis
afq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AFA_02595
   00670 One carbon pool by folate
    AFA_02595
Enzymes [BR:afq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AFA_02595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ASR88437
Position
complement(571169..571663)
Genome map
AA seq 164 aa AA seqDB search
MSSSPIIRLVVAYAANRCIGKDNDLPWRLPSDLQHFKRVTMGLPIIMGRKTWESLGRPLP
GRPNLVISRNADYQAEGAQIFSNLDDALAACPGFDTACVIGGEQLFRLALPMAQELIATE
IKADVDGDTFFPELPVGQWQEVERLPQPEENGFTYDYVTYRRRR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagttccagccctattattcgtctggtcgttgcctatgccgctaatcgctgcataggc
aaggataacgacctgccctggcgtctgccttcagacttgcagcacttcaagcgcgtgact
atgggtttgcccatcatcatgggtcgcaagacctgggagtcgctgggccgtcccctgccc
ggccgcccgaacctggtgatcagccgcaatgcggattaccaggcagaaggcgcacagata
ttcagcaatctggacgacgcgctggccgcctgtcctggcttcgacaccgcttgcgtgatt
ggtggcgagcagctcttccgtctggccctgcctatggcgcaagagctgatcgcaaccgag
atcaaggctgatgtggacggcgacaccttctttccagagctacccgttggccaatggcag
gaagtagaacgtctgccccagcccgaggaaaatggcttcacttacgactatgtgacctat
cgccgccgtcgttag

DBGET integrated database retrieval system