KEGG   Alcaligenes faecalis JQ135: AFA_13980Help
Entry
AFA_13980         CDS       T05446                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
afq  Alcaligenes faecalis JQ135
Pathway
afq00970  Aminoacyl-tRNA biosynthesis
afq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AFA_13980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:afq03029]
    AFA_13980
Enzymes [BR:afq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AFA_13980
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AFA_13980
Mitochondrial biogenesis [BR:afq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AFA_13980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ASR90463
Position
3025383..3026795
Genome map
AA seq 470 aa AA seqDB search
MNKDLLELSVIDLADKLRSKAVSPVEVTDNLLAYIEQSNKQTNAYISVTAEQARKSAKQA
EQDIMAGKYKGVFHGVPLALKDNIYFANEVTTMASKIHKDFVSKDDATVATKLRDAGVIF
TGKLNMHEYAWGIDNNNPHFGAVHNPWNADRVPGGSSGGSGAAVASHSSYNTLGTDTAGS
IRIPSAACGIVGLKPTHGRVSKFGVYPLAWTLDHVGPMSKTVADAAAMLEVIAGFDGRDP
TCAKVPVGSYLNALNGNVKGLRIGIIEDYFFKNVDAGIEKVIRDRLADLEKQGAKVIPLN
VPALRYSEWAELAVSLTEAATIHHQDLIKRPEDFGGDIRFLFELGELFSGIDYLQAQQVR
RALKQQFTATFNDVDVIIAPTLPCQVPNIGTDTVNINGKTLDFIDEGIRFTGPSNLTGLP
AITVPAGISEGMPVGLQIIGPAFEEARILNVAYAVENMKPLAGHQPVLKP
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagacctacttgaactgagcgttatcgacctggccgacaagctgcgcagcaaa
gccgtctctcccgttgaagtgaccgacaacctgctggcctacatcgagcaatccaacaag
caaaccaacgcctatatttccgttaccgctgagcaggcccgcaaaagcgccaaacaagcg
gaacaggacatcatggccggaaagtacaaaggcgttttccacggtgttccgctagccctg
aaagacaatatttactttgcgaacgaggtcaccaccatggcctccaaaatccacaaggac
tttgtctccaaagacgacgccaccgtggctaccaagctgcgcgatgccggggtgatcttc
accggcaagctgaacatgcacgaatacgcctggggcatcgacaacaacaacccgcacttt
ggtgccgtccataatccctggaatgccgaccgcgtccccggtggctccagcggtggctcg
ggtgcggccgtggcctcccacagctcctacaacaccctgggcaccgacaccgccggttcc
attcgtatcccatcggctgcatgcggcatcgtcggcctgaaacccacccatggccgcgtc
agcaaattcggcgtctaccccctggcctggaccctggaccacgtaggccccatgtccaaa
accgtcgctgacgccgccgccatgctggaagtaattgctggttttgatggccgcgacccc
acgtgcgccaaggtcccggtcggctcctacctgaacgcgctcaatgggaatgtcaaagga
ctgcgcattggcatcatcgaagactatttcttcaagaacgtagacgccggtatcgaaaaa
gtgatccgtgaccgcctggccgacctggaaaaacaaggggccaaagtcatcccgctgaac
gtccccgccctgcgctactccgaatgggccgaactggcagtcagcctgaccgaagccgcc
accatccaccaccaggacctgatcaagcgccccgaggattttggcggcgacatccgcttt
ctgtttgaactgggcgaactgttcagcggcatcgactacctgcaagcccagcaagtacgc
cgtgcgttgaaacagcaatttaccgccaccttcaacgacgtagacgtcatcattgccccc
accctgccttgccaagtacccaatatcggcaccgataccgtcaatatcaacggcaaaacc
ctggacttcatcgatgaaggcatccgctttaccggccccagcaacctgaccggcctaccc
gccatcaccgtacccgccggtatatctgagggcatgcccgtgggcctgcaaatcatcggc
cccgcctttgaagaagcccgcatcttgaacgtcgcctacgccgtggaaaacatgaaacca
ctggcaggacaccagcccgtcctgaaaccgtaa

DBGET integrated database retrieval system