KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0267Help
Entry
AFE_0267          CDS       T00810                                 

Gene name
sqr
Definition
(GenBank) sulfide quinone reductase, putative
  KO
K17218  sulfide:quinone oxidoreductase [EC:1.8.5.4]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AFE_0267 (sqr)
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.4  bacterial sulfide:quinone reductase
     AFE_0267 (sqr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 DAO NAD_binding_9 NAD_binding_8 Thi4
Motif
Other DBs
NCBI-ProteinID: ACK80058
UniProt: B7J411
Position
complement(241295..242422)
Genome map
AA seq 375 aa AA seqDB search
MTQVTIIGAGFGGLTAVRHLRRRMPDAEITVIAPRAEFVYYPSLIWIPTGLRQGENLRIP
LDRFFQRRRVQFHQGRVTGLRDGGRTVITDQGEVRNDALIIASGGRGIRKLPGIEHSFAI
CDGIDAAENIRDRLALMDKGTIAFGFAGNPLEPTAVRGGPVFELLFGIDTYLRQIDKRGQ
IELVFFNPMTEPGNRLGPKAVEGLLAEMQRRDIRTHLGHKISGFSVNKVMTEGGDIAADL
ILFMPGMTGPDWAADSGLPLSAGGFFQSDLHCTVPDHPGVFVIGDGGSYAGSPDWLPKQG
HMADLQAGTAVHNLLLHLQGKAADNTFRSELICIVDTLDSGIMVYRSPNHASILPNSLWH
AAKVAFEWRYLLHYR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagtgaccattatcggcgcaggctttggtggcttgacggccgtccgccacctg
cgtcgccggatgcccgacgcggaaatcaccgtcatcgcacccagggcggagttcgtttac
taccccagcctgatctggattcccaccgggctgcggcaaggcgagaatctgcggattccc
ctggaccgtttctttcagcgccgacgagtgcagtttcatcagggtcgcgtcactggcctg
cgcgatggcggccgtaccgtcatcaccgaccagggtgaagtgcggaacgacgcgctcatc
attgccagcggcggtcgcggtattcgtaagctgccgggcatcgaacacagtttcgccatc
tgcgacggtatcgatgccgccgaaaacatccgagaccgcttggcgctgatggacaaaggc
accattgccttcggtttcgccggcaatcccctggagccgaccgccgtacgcggtggtccg
gtctttgaactgctctttggaatcgacacttaccttcgtcagatcgataagcgcgggcaa
atcgaattggtatttttcaatccgatgaccgaaccgggtaatcgactgggtccgaaggcg
gtggaaggactgctcgcggaaatgcagcggcgcgatattcgcacccatcttggtcataaa
atcagtgggttctcggtaaacaaagtgatgaccgaaggcggcgacattgccgcggacctg
atcctgttcatgcccggcatgaccggcccggactgggcagccgacagcggtttgcccctc
tctgccggtggcttttttcagtccgacctgcactgcaccgtccccgaccatccgggcgtc
tttgtcattggtgacggggggtcctacgcgggcagcccggactggctacccaagcagggc
cacatggcggacctgcaggccgggaccgccgtgcataacctgctcctgcatctgcagggg
aaggcggcagacaataccttccgcagcgagttgatctgcattgtcgacaccttggacagc
ggcatcatggtctatcgcagccccaatcatgccagcatcctgccaaactcgctctggcat
gcggccaaggtcgcctttgagtggcgttatctgttgcattaccgctga

KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1792Help
Entry
AFE_1792          CDS       T00810                                 

Definition
(GenBank) sulfide-quinone reductase, putative
  KO
K17218  sulfide:quinone oxidoreductase [EC:1.8.5.4]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AFE_1792
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.4  bacterial sulfide:quinone reductase
     AFE_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox DAO GIDA Pyr_redox_3 Trp_halogenase NAD_binding_8 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACK80359
UniProt: B7JBP8
Structure
PDB: 

Position
1556784..1558088
Genome map
AA seq 434 aa AA seqDB search
MAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAF
PIRHYVERKGIHFIAQSAEQIDAEAQNITLADGNTVHYDYLMIATGPKLAFENVPGSDPH
EGPVQSICTVDHAERAFAEYQALLREPGPIVIGAMAGASCFGPAYEYAMIVASDLKKRGM
RDKIPSFTFITSEPYIGHLGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYVTQ
VDEKGETIKEMVLPVKFGMMIPAFKGVPAVAGVEGLCNPGGFVLVDEHQRSKKYANIFAA
GIAIAIPPVETTPVPTGAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVCFADM
GDRGAAFIALPQLKPRKVDVFAYGRWVHLAKVAFEKYFIRKMKMGVSEPFYEKVLFKMMG
ITRLKEEDTHRKAS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcacatgtggtaattttgggtgcgggcacaggcggaatgccggcggcctacgaaatg
aaggaagctctgggttctgggcatgaggtgacgctgatcagcgccaatgattatttccag
ttcgttccgtccaacccgtgggtgggggtgggctggaaggagcgcgatgatatcgctttc
ccaatccggcactatgtggaacgtaaaggaatacattttatcgcgcagtccgccgaacag
atcgatgccgaagcgcagaatatcacccttgccgacggcaacacggtacattacgactac
ctgatgatcgcgacaggtccgaagctggctttcgagaatgtaccgggttccgatccccat
gaaggcccggtgcagtccatttgtacggtggaccatgcggaacgggcctttgccgaatac
caggctttgttgcgcgagcccggccccattgtcatcggtgccatggccggcgcaagttgc
ttcggaccggcttacgaatatgccatgatcgtcgcttccgacctcaaaaaacggggcatg
cgcgacaagattccgtccttcacctttatcaccagtgagccctacatcggtcatctgggc
attcagggcgtgggcgattccaagggcattctgacgaagggcctcaaggaagaaggtatc
gaagcgtacacgaactgtaaggtcaccaaggtcgaagacaacaagatgtatgtaacccag
gtggacgagaagggtgaaaccatcaaggagatggttctgccggtcaagttcgggatgatg
atcccggctttcaagggcgtgccagcggtggcgggtgtcgaaggattgtgcaatcccggt
ggcttcgtgctggtggatgagcaccagcgcagcaagaaatacgcaaatatctttgcggcg
ggtatcgccatcgccattccgccggtagagacgaccccggtgccgaccggcgcgcccaag
accggttatatgatcgaatccatggtgtcggcggcggtgcacaacatcaaggcggatctg
gaaggccgcaagggcgagcagaccatgggcacctggaatgcggtgtgttttgccgatatg
ggtgatcgcggcgcggcatttatcgccttgccccagttgaagccccgtaaagtggacgtc
tttgcctacgggcgctgggtgcatctggcgaaggtggcctttgaaaaatactttatccgc
aaaatgaagatgggtgtctccgagcccttctatgagaaggtgctgttcaagatgatgggc
attacccgtctgaaggaagaagatacccatcgtaaggcctcctga

KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2601Help
Entry
AFE_2601          CDS       T00810                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase
  KO
K17218  sulfide:quinone oxidoreductase [EC:1.8.5.4]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AFE_2601
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.4  bacterial sulfide:quinone reductase
     AFE_2601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACK79733
UniProt: B7J7R8
Position
2308695..2309834
Genome map
AA seq 379 aa AA seqDB search
MRILVVGGGMGGTIFANHLARRIHHEMKTGKARITMLSASHEHVYQPGWLYVAMGRTTPD
ELVREQQGLLEPGIEFHVDPVEEFHLADNHVQCKSGKVHEYDVIVISTGSRPMPENIPGL
KENSINCYTAENAVEFFRQLSDFKGGRIVVTVGLPHKCPMIPLEITFAMHDFIQDRGLLD
KTEFYYTYPIGRVHSLENVAKWAAPEFDRMGIQYETLFNMKEVDGKNAQVLSEEGGAVKY
DLLVAVPPHKGQEVIEKNGLGENGWIPTNRTSLHMEGEYGKNVIILGDTTNLPISKAGST
THFEAEVAAENVAAVIKIGRPVRSYDGKVFCFIEAGKDRATYAMFDYQHPPQPKAPTGAV
HAFKMAYNQLYWASARGLL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagaattctcgtcgtcggtgggggtatggggggcaccattttcgccaatcatctggcc
cgccgtatccaccatgaaatgaaaaccggcaaggcgcgcatcaccatgctctcggccagc
cacgaacacgtctatcagcccggctggctttatgtggccatgggccggacgaccccggat
gaactggtccgcgaacagcagggcctgctggagcccggtatcgagtttcatgtcgatccc
gtggaggagtttcatctggctgacaatcatgtccagtgcaagagcggcaaggtccatgag
tatgatgtcatcgtcatttccaccggctcccgtcccatgccagaaaacatccccggcctc
aaggagaactccatcaactgttataccgcggagaatgcggtggagttcttccggcaactc
tcggacttcaagggggggcgcatcgtcgtcaccgtcggtctgccgcacaagtgtccgatg
atcccgctggaaatcaccttcgccatgcacgatttcattcaggatcgtggcctgctggac
aagaccgagttctactacacctatcccatcggtcgggtgcacagcctggagaatgtggcg
aagtgggcggcaccggaattcgaccggatgggcatccagtacgagaccctgttcaacatg
aaggaagtcgatggcaaaaatgcccaggttctcagtgaggaggggggtgccgtcaagtat
gacctgttggtggcggtgccgccgcacaagggtcaggaagtcatcgagaagaatggcctc
ggggagaatggctggattcctaccaaccgcacgtccctgcacatggaaggggaatacggc
aagaatgtcatcatcctgggggataccaccaacctgccgatcagcaaggccggctccacc
acgcatttcgaggcagaggttgccgccgaaaatgtcgcggcggtgatcaagatcgggcgg
ccggtacgcagttacgatggcaaggtcttctgcttcatagaagcgggcaaggatcgcgcc
acgtatgccatgtttgattaccagcatcctccgcagcccaaggccccgaccggtgcggtc
catgccttcaagatggcctacaaccagctctattgggccagtgcccgcggcttgctctaa

KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3118Help
Entry
AFE_3118          CDS       T00810                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase
  KO
K17218  sulfide:quinone oxidoreductase [EC:1.8.5.4]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AFE_3118
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.4  bacterial sulfide:quinone reductase
     AFE_3118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACK80497
UniProt: B7J7R8
Position
2804238..2805377
Genome map
AA seq 379 aa AA seqDB search
MRILVVGGGMGGTIFANHLARRIHHEMKTGKARITMLSASHEHVYQPGWLYVAMGRTTPD
ELVREQQGLLEPGIEFHVDPVEEFHLADNHVQCKSGKVHEYDVIVISTGSRPMPENIPGL
KENSINCYTAENAVEFFRQLSDFKGGRIVVTVGLPHKCPMIPLEITFAMHDFIQDRGLLD
KTEFYYTYPIGRVHSLENVAKWAAPEFDRMGIQYETLFNMKEVDGKNAQVLSEEGGAVKY
DLLVAVPPHKGQEVIEKNGLGENGWIPTNRTSLHMEGEYGKNVIILGDTTNLPISKAGST
THFEAEVAAENVAAVIKIGRPVRSYDGKVFCFIEAGKDRATYAMFDYQHPPQPKAPTGAV
HAFKMAYNQLYWASARGLL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagaattctcgtcgtcggtgggggtatggggggcaccattttcgccaatcatctggcc
cgccgtatccaccatgaaatgaaaaccggcaaggcgcgcatcaccatgctctcggccagc
cacgaacacgtctatcagcccggctggctttatgtggccatgggccggacgaccccggat
gaactggtccgcgaacagcagggcctgctggagcccggtatcgagtttcatgtcgatccc
gtggaggagtttcatctggctgacaatcatgtccagtgcaagagcggcaaggtccatgag
tatgatgtcatcgtcatttccaccggctcccgtcccatgccagaaaacatccccggcctc
aaggagaactccatcaactgttataccgcggagaatgcggtggagttcttccggcaactc
tcggacttcaagggggggcgcatcgtcgtcaccgtcggtctgccgcacaagtgtccgatg
atcccgctggaaatcaccttcgccatgcacgatttcattcaggatcgtggcctgctggac
aagaccgagttctactacacctatcccatcggtcgggtgcacagcctggagaatgtggcg
aagtgggcggcaccggaattcgaccggatgggcatccagtacgagaccctgttcaacatg
aaggaagtcgatggcaaaaatgcccaggtcctcagtgaggaggggggtgccgtcaagtat
gacctgttggtggcggtgccgccgcacaagggtcaggaagtcatcgagaagaatggcctc
ggggagaatggctggattcctaccaaccgcacgtccctgcacatggaaggggaatacggc
aagaatgtcatcatcctgggggataccaccaacctgccgatcagcaaggccggctccacc
acgcatttcgaggcagaggttgccgccgagaatgtcgcggcggtgatcaagatcgggcgg
ccggtacgcagttatgatggcaaggtcttctgcttcatagaagcgggcaaggatcgcgcc
acgtatgccatgtttgattaccagcatcctccgcagcccaaggccccgaccggtgcggtc
catgccttcaagatggcctacaaccagctctattgggccagtgcccgcggcttgctctaa

DBGET integrated database retrieval system