KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0282
Entry
AFE_0282          CDS       T00810                                 

Gene name
fur
Definition
(GenBank) ferric uptake regulation protein
  KO
K03711  Fur family transcriptional regulator, ferric uptake regulator
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Brite
KEGG Orthology (KO) [BR:afr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:afr03000]
    AFE_0282 (fur)
Transcription factors [BR:afr03000]
 Prokaryotic type
  Helix-turn-helix
   Fur family
    AFE_0282 (fur)
SSDB
Motif
Pfam: FUR HTH_12 HTH_Tnp_Tc3_2 PadR MarR SAM_2 TF_Zn_Ribbon DprA_WH HTH_21
Other DBs
NCBI-ProteinID: ACK80623
UniProt: B7J425
Position
252540..253016
AA seq 158 aa
MIDERMNSDELKRAGLKATLPRLKILRIFEDSDARHLTAEEIYRLLLETGEEVGLATVYR
VLTQFEMAGLVRRHHFEGDKAVFELNETGHHDHMVCTACGKVLEFFDEMLEARQRELAAN
RGFFISDHSLYLYGTCLGMQDVGICSLRDDDAPGASTD
NT seq 477 nt   +upstreamnt  +downstreamnt
atgatcgacgaacgaatgaacagcgatgaattgaagcgcgccggcctcaaggcgaccctg
ccgcggctgaagatacttcgcatttttgaggacagcgacgcacggcatcttactgccgag
gaaatctaccggctgttgctggagaccggtgaagaagtgggcctggcgacagtctatcga
gtgcttacgcagtttgaaatggccggattggtgcgaaggcaccactttgagggcgataag
gcggtctttgagctcaatgaaaccggccaccacgatcatatggtgtgtactgcctgtggt
aaggtactggagtttttcgatgagatgctggaggcccggcagcgggaactcgctgcgaac
cggggcttctttatcagcgaccacagcctctatctctatggcacctgtcttggcatgcag
gacgtggggatttgttcactaagggacgacgatgcacccggagccagcacggattag

DBGET integrated database retrieval system