KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0299Help
Entry
AFE_0299          CDS       T00810                                 

Gene name
ribBA
Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00740  Riboflavin metabolism
afr00790  Folate biosynthesis
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AFE_0299 (ribBA)
   00790 Folate biosynthesis
    AFE_0299 (ribBA)
Enzymes [BR:afr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     AFE_0299 (ribBA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     AFE_0299 (ribBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ACK78065
UniProt: B7J443
Position
268748..269881
Genome map
AA seq 377 aa AA seqDB search
MSSASISSAEEIIADIAAGRMVILMDDEGRENEGDLIMAAEFVTPAAINFMVSQGRGLVC
LPLTRERCERLRLPQMVGHNTASLGTAFTVSIEAARGVTTGISAADRAVTIRAAIADEAG
PEDIVMPGHIFPLAAEPGGVLVRAGHTEAAVDLARLAGCKPAGVICEILNVDGEMARLPD
LLPYAAEHGLKIGTIADLIRYRLERERIVQREASGPWHTPCGDFELHVYRDWVARETHFA
LVLGDLEARDEPVLVRVQVGKTLNDLFAGEASPNVIALRRIAAEGRGVLVYLHHQESVEE
LLREIAALPEKPKGPGQAGDAGRVLRTFGIGAQILSDLGVHQAVVLSDSQFQYRGIGGFG
LEIVGQRPFLEVPEDES
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgccagtataagttccgcagaggagatcatcgccgacatcgctgccggtcgg
atggtgattctgatggacgacgaggggcgtgaaaacgaaggtgatctgatcatggcggcg
gagtttgtgacgcccgccgccatcaatttcatggtttcgcaggggcgtggtctggtgtgc
ctgccgctcacccgcgagcgttgcgagcgattgcgcctcccgcagatggtagggcataac
actgccagcctgggcaccgcgttcacggtgtcgattgaggctgcccgcggtgtcaccacg
ggcatttccgctgctgaccgcgcggtgacgattcgggcggccattgcagacgaggcaggc
ccggaggatatcgtgatgcccggtcacattttccctctggccgcagaacccgggggcgta
ctggttcgcgccggtcataccgaagcagcggtcgaccttgcacggctggctggctgcaaa
cccgccggtgtcatctgcgaaattctcaatgtcgacggcgaaatggcgcgtttgcccgac
ctgctcccctatgctgcggaacatggcctcaaaattggcaccattgccgacctgatccgc
tatcgcctggaacgggagcggatcgtacagcgggaggcgagcggcccgtggcatacccca
tgtggcgacttcgaactccacgtttatcgtgactgggtcgcccgtgaaacgcattttgcc
ctggttcttggcgacctggaagcgcgtgatgaacccgtactggtaagggtacaggttggc
aagacgctgaatgatctcttcgccggtgaagccagcccgaatgtcatcgccttgcggcgg
atcgctgcagaaggtcgtggcgtgctggtctatctccaccatcaggagagtgtcgaagaa
ctcctgcgcgagatcgccgcattgcctgaaaagcccaaggggcccggtcaggcgggtgac
gccggacgggttctgcgcacctttggcatcggcgcccagattctctctgatctgggggtg
catcaggcggtggtcctcagcgacagtcagtttcaataccgtggtatcggcggcttcggt
ctggagatcgtcggccagcgtccctttctggaagttcccgaggatgagtcatga

DBGET integrated database retrieval system