KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1047Help
Entry
AFE_1047          CDS       T00810                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:afr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AFE_1047
Enzymes [BR:afr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AFE_1047
DNA repair and recombination proteins [BR:afr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AFE_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 HHH_5 Helicase_RecD IstB_IS21 AAA_22 AAA_16 DnaB_C PIF1 NTPase_1 UvrD_C AAA RsgA_GTPase T2SSE AAA_28 Flavi_DEAD Zeta_toxin NACHT AAA_25 AAA_24
Motif
Other DBs
NCBI-ProteinID: ACK80668
UniProt: B7J7Z5
Position
943788..945923
Genome map
AA seq 711 aa AA seqDB search
MPEMQTLIGQVTRLIFSGKADSFRIFEVQIKGANKREIVTGEWQRARVGANIEAAGTWEK
RKGKDEIQFKARSILEIVPTSADSILSWLEGGAVKGIGKVSAKKLVACFGAGLLEILDQH
PERIVEAGIGKKQREKIIEGWKIASATRIIMQFLREVGIGPERSNAVWRQFKDHPAIAGQ
PAVLVARLRNNPYRLIRVRGIGFSLADQAAGKLGIRADADYRVDAGIEHTLQTRTEDGHV
WTPEPTLLGLCKELLGVSQEKIVARIQVMQEAQQIATELGAPNRFASVRLSRMEISLAAK
IRSLSGPAPKKTMRFPAGFVPDPTQIEALNQISDRKLAILAGGPGMGKTTLLKTCAQSAV
ASGMRVALCAPTGRAAKRMNEATGMEAKTIHRLLEMKRGGLAERNRDNPIEADWIIVDEV
SMLDMELAWKLFDAIPARARVLLVGDPDQLPSVGPGQVLADLIACGKVTVARLSKIFRQQ
AGSGIPVMATQVIQGVVPNLDPDSSDCPFVDAECIGEESEEATAVVVRRIVQESEKLGSR
MQALAPMRNGPLGTLKLNQALREAFNPDAGQPHRGRFRLGDWVIQTRNNYDLDVYNGDLG
TVVAIEEGDEQAVVVDFEDRVVRYEDNEDLRDLDHAYCLTIHKSQGGQFPGVAMVATTAH
FVMLKRNLLYTGMTRAEKHLLLISTKRALQIACKKSGIEKRDTLLAQRIGG
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaatgcagacgctcatcggccaggtcacccgccttatcttctcaggcaaggcg
gattcctttcgcatttttgaggtgcagatcaagggcgcgaacaagcgcgagattgtcacc
ggcgagtggcaacgggcccgtgtgggcgcgaacatcgaagcggcgggaacctgggagaag
cgcaaaggaaaggatgaaattcagttcaaagcccgttctattctggaaatcgtaccgaca
agcgccgacagcattttgtcttggcttgagggcggggcggtaaagggcattggcaaggtg
tccgcgaaaaagctggtggcctgcttcggcgctggattgctggagattctggaccagcat
ccagaacggatcgtggaggccggtatcggcaagaaacagcgcgaaaagattatcgagggc
tggaaaatcgcgtccgccaccagaatcatcatgcagtttcttcgggaagtcgggattggc
ccggaacgctccaacgcggtatggcgccagttcaaggatcaccccgccatcgctggccag
ccggcggtgctggtggcccggctgcgcaacaacccctatcgcctgatccgcgtgcgcggc
atcgggttctcgttggccgaccaggcggccggcaaactgggcattcgcgccgacgcggat
tatcgggtggacgcggggatcgagcacactctgcaaactcgcaccgaagacggtcacgtt
tggactcccgagccgacgttgctgggcctttgcaaagaattgctgggcgtcagccaggaa
aagatcgtggcgcgcatccaggtgatgcaggaagcacagcagatcgcgactgaactgggc
gcgcctaatcgcttcgccagcgtacgtctttccagaatggaaatttccctggcggccaag
attcgctccctgtctggtccggcgcccaagaaaacgatgcgcttccccgccggattcgtt
ccggatcccacgcaaatcgaggcgctgaaccagatcagcgatcgcaagctggcgattctg
gccggcgggccaggcatgggaaagaccaccctactcaagacctgcgcacagtcggcagtg
gcgagcggcatgagggttgctctttgcgccccaaccggccgtgcggccaaacgcatgaac
gaggcgacgggcatggaggccaagaccattcatcggctgttggagatgaagaggggtggg
ctggcggagcgtaatcgggacaaccctatcgaagcggactggatcatcgtggacgaggtc
tccatgctggatatggagttggcctggaagctgtttgacgccattccggcccgtgcccgc
gtgctgctggtcggcgatccggaccagttgccttccgtgggccccgggcaagttctggcc
gatctcattgcctgcggcaaggttacggtggccaggttgagcaagatcttccggcagcaa
gccgggtccggtattccggtgatggccacccaggtcattcagggcgtcgtgccgaacctg
gatcccgattcgtcggattgtccgttcgtggatgcagaatgcatcggggaagaaagcgag
gaggcgacagcggtggtggtgcggcgcatcgtccaagagtcggaaaaactgggcagccgc
atgcaggcgctggcgcccatgcggaacggtccgctgggcacgctgaagctcaaccaggcc
ttgcgtgaggcgttcaacccggatgccgggcagccgcaccggggccggttccggctgggg
gactgggtaattcagacgcgcaacaactacgacctggatgtctataacggcgatctgggt
accgtggtggccatagaggagggcgacgaacaggccgtggtggtggatttcgaggatcgc
gtcgtccgctatgaggataatgaggacttgcgggatcttgatcacgcgtattgcctgacc
atccacaagtcccagggtggccagtttcccggggtcgccatggtggccactaccgcgcac
tttgtcatgctcaagcgcaatctgctgtacacgggcatgacgcgggccgagaagcatctg
ctgctgatctcgacgaaaagggccctgcagatcgcgtgtaagaaatccggcattgagaag
cgggacacgctgttggcccagaggatcggcggatga

DBGET integrated database retrieval system