KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1066
Entry
AFE_1066          CDS       T00810                                 
Name
(GenBank) pilus assembly protein TraF, putative
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Brite
KEGG Orthology (KO) [BR:afr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afr02044]
    AFE_1066
Secretion system [BR:afr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   AFE_1066
SSDB
Motif
Pfam: TraF
Other DBs
NCBI-ProteinID: ACK80154
UniProt: B7J814
Position
958886..959899
AA seq 337 aa
MGHCSNQRIHHGNVLAIAVATTFIGLCLSFCGPDVAQANVLSGDTHGWFWYQLPPPPPKP
LPPPRPVVQAPPKPAPVKKVAPKPAGPKVFSVQWIKKTLPKWRNRAINDPSTKNVTQYLA
LQKVMFDKAQNFAERFVQVANTNPVLNYSAIIPRSGAGNTDFQSYLQQNKMRALRYLSKH
VGMWVFVKHGCPFCDMQLTQYGNMNQMIHFATDYIDVNNGPITGLPKNAVLVQDHGQAKD
LHLVETPTIIMIYPPDNFAIIAQGYQVMGSLEDNILADAEYLHLLPKKLTEWTGANAYER
GVLTTAQMKQAQNQKNANPQTITQYIENATASRISNW
NT seq 1014 nt   +upstreamnt  +downstreamnt
ttgggccactgtagtaaccagcggattcaccatggaaatgtccttgcgatagccgtcgcg
acgacgtttattggtttgtgcctgtcgttctgcggacccgatgtcgctcaggctaatgtg
ctttccggcgacacacacggctggttttggtaccaattgccacctccaccgcccaagcca
ctgccaccacccagacccgtggtgcaggcaccgccaaaacccgctccggtgaagaaggtc
gcgcccaaaccggcgggaccgaaggtcttttcggtgcagtggattaaaaaaacattgccc
aaatggagaaatcgggcgatcaacgacccaagcaccaagaatgtcacgcaatacttggcg
ttgcagaaggtcatgttcgataaggcccagaatttcgcagagcgattcgtccaagtcgcc
aacacgaatccggtgctcaattattccgcgatcattccacgatccggcgcaggcaatacg
gatttccagtcctatttgcagcagaataaaatgcgggcactgcgctatttgagcaaacac
gtcgggatgtgggtgttcgtgaagcatggatgcccgttttgcgacatgcagttgacgcag
tacggcaatatgaaccagatgatccatttcgctactgactatatcgacgtgaataacggg
ccgattacgggtctaccgaaaaatgcggtgcttgtgcaggatcatggccaggcgaaggat
ttgcacctggtcgagaccccgaccatcatcatgatttatccgcccgataattttgcgatt
atcgcgcagggttaccaggtcatgggcagcctcgaggacaatatcctggcggacgccgag
tatctgcatctcttgccgaaaaagctcacggaatggaccggggccaatgcatatgagcgc
ggagtgctgaccacggcacagatgaagcaagcgcagaaccagaaaaacgcgaacccgcag
accattacgcagtacatcgaaaacgccacggcatccagaatctcaaattggtga

DBGET integrated database retrieval system