KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1068
Entry
AFE_1068          CDS       T00810                                 
Name
(GenBank) pilus assembly protein TraG, putative
  KO
K12056  conjugal transfer mating pair stabilization protein TraG
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Brite
KEGG Orthology (KO) [BR:afr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afr02044]
    AFE_1068
Secretion system [BR:afr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   AFE_1068
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: ACK80470
UniProt: B7J816
Position
961593..965249
AA seq 1218 aa
MYIYVVGNIQSFFSVLTGIQMLFNPANNTLWASQGTNASGFPGSWALGLGLMFGFIIMIL
TGMNNLRIEFHKMLIIMVVFMALWEVQTSATVENMLTGNSVTVQGIPIGIVYPAAIFSTI
AYDAAEEIGQADQNAGNNNPSLFTGSYNSNYGFAGPLALTYKLRGLYSVFNEYDSPLSGS
VAQYVDHCIIPQASVVDSGELIDSPDLAATLFTGPNAIAPSNNQVPIDVNGSNQATAWQS
VPCSTAQSTLSNAWSTFYGGAGSNSLNNVVSMKTQSNGKTGVDASTAESVLQTMFTTTAN
GGQNFIGNLILNCAAEAGNAQAASDMSSSADVTDPSTLSPYCTTKAAALGRQQAMNAGSA
SLFESNMIPTMALLQFLFFAMAPLTLIIAAMMGVQGLPMLGKYMIFGAWTESWIPVAQII
NDYIQQTTNQLYANIQTAAAATSITTPGGGTMTMSATSSANIPMILTHAMNALSMADMMM
SATPIITLVLLTGSYFALTQLGSKISGNDVVDKNMSESTPTNGTNVMASGAYGVGVNNPG
TVGGSYGSTAPLNAVSYSASSGINATTTQSEAAQASLTRQATESAGITAQNMSSLINSQS
AGVQSALTQTAGAQHAAKVARHAQTQYMSDFGFSKDNALTFAGILSGELATGGQITGEMV
KGLVGKLGGSATGQQAAKFADSIKSGDGLKQLEDFSHAEEALSSNGLESKLSHTDQKGTA
AAIGTSTAKTRSLLSARNAVETQSAGLAKAAVAAQSAGGNINFDVANTAPAITDTAAAIG
HVSGNEWARMSIIAATGRNGQASEDAALAQFDQLHKRGMAIYGGSNEAATGYALISMARS
MPNKAEATEMLARATGHHELAAAAAGMARDMQNIQRAVAGAGVAIDPSATGSVPDLVSQV
GGATGAPSAGATQAQYQADHGAAASNVNNSTGAADWNPSAVTGFFQGAQSDVANHGPGAK
LLNQAMGMFGSGVMTPQQAQQGMGKERGAYIDKAARLGSEDPNLTSLALGATGLGGMAAA
LALGGGLKKMMGNKAAQADLEKGMSPEEQQAMSEAANEMADGKSFGDLTEAQQGAVMKAT
GNLNSVANAKITQELGTKTMDSYNSGVEKMLNGKANEITPGERASIAKVAQARQAITDKL
GLSKAPSGGEAVDSGGDGIAQGNSGAEEANGQVPGESVGADPLDPGSPPSVPVEKTVVPM
FPGQDGYQGPSNSPGSKE
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgtacatttacgtcgtcggcaacattcagtctttctttagcgtcctgaccggcatacag
atgctgttcaacccggcgaacaacaccctgtgggcaagtcagggcaccaacgcgtcaggc
ttccctggcagttgggcgctggggctggggttgatgttcgggttcatcatcatgatcctg
accggcatgaacaatctgcgcatcgaattccacaaaatgctgattatcatggttgttttc
atggcgctctgggaagtgcaaaccagcgccacggtggaaaacatgctgacgggtaattcc
gtgacggtgcaaggcatacccatcggcattgtctatccggccgccattttttcgaccatc
gcctatgatgcggcggaagaaatcgggcaggccgatcaaaacgccggcaacaataacccc
tctttgttcaccggaagctacaacagcaattacggttttgccggcccgctggcgctgacg
tataaactgcgagggctgtacagcgttttcaatgagtatgactccccgctttccggatcg
gtcgcgcaatacgtggatcattgcatcattccgcaagcatccgtggttgattctggcgaa
ctcatcgacagcccggatctggccgcaacgctgttcaccggcccaaacgccatagctcca
tccaataaccaggtacctatcgatgtaaacggctccaatcaggccaccgcatggcagtcg
gtaccctgttccaccgcgcaatcgacgttgagcaatgcctggagcacgttttacggcggt
gccgggagcaatagcctcaacaacgtagtttccatgaaaacgcagagcaacgggaaaacc
ggtgtggatgccagtacggcggaatctgtcctgcaaaccatgttcactaccacggcgaac
ggcgggcagaacttcatcggaaacctgattctgaattgcgcggcggaagccgggaacgcg
caggccgcgagcgacatgagcagcagcgcggacgtgacggatccgtccactctttctccg
tactgtaccacgaaagcggccgccctgggccgacagcaggccatgaacgcggggtcggcg
tcgctcttcgagagcaacatgatcccaaccatggcgctcctgcaattcctgtttttcgcc
atggcgccgctgaccttgatcatcgccgcgatgatgggcgtacagggcttgccgatgctg
ggcaagtacatgatttttggtgcatggacggaatcctggatccccgttgcccagatcatc
aacgattacatccagcagaccaccaatcagctctatgcgaatatccagacggcggcggcg
gcgaccagtattacgacccccggcggcggcacgatgacgatgtccgcgacctcatcggcc
aacatccccatgatcctgacccatgccatgaacgccctttccatggcggatatgatgatg
tcggcgaccccgatcatcaccctggtgcttctgaccggctcctatttcgcgctgacgcag
ctcggcagcaagatctcgggcaacgacgtggtggacaagaatatgagcgagtccacgcct
acaaacggcacgaatgtgatggcgagcggggcgtatggggtgggggtgaataaccctggg
accgtgggcggaagctacgggtcaaccgcgccgcttaatgctgtttcttactccgcttcg
agtggcatcaacgcgacaacgacccaatcggaagccgcacaggcgagtctgacgcggcag
gcgaccgaaagtgccggtataaccgctcaaaatatgtcgtcgttgatcaatagccagtcc
gctggcgtgcagagcgcgctcacacaaacggcaggggcgcagcatgccgccaaagttgcg
cggcatgcacaaacacaatacatgagtgactttggttttagcaaagataatgcgctgact
tttgctgggatattgtctggtgaacttgcaacaggagggcaaatcactggagagatggtg
aagggactggtcggaaagttgggggggtcagcgactggccagcaagcagcgaagttcgcg
gacagtatcaaaagtggcgatggcctgaaacaactagaggattttagtcacgcagaagag
gcgctaagttccaacggacttgagagcaaattgtcccataccgatcaaaaaggaaccgct
gcggccattggaacatcaaccgcaaaaaccaggtctcttctgagtgctcgtaatgccgta
gaaacgcaaagtgcaggcctggccaaggccgccgttgcggcgcagtctgccggcggaaac
atcaattttgatgtcgcgaatacggcgccagcgattaccgataccgcagcggccatcggt
catgtaagtggaaatgaatgggccaggatgtcgattatcgccgcaaccggccggaacggc
caggccagcgaggatgccgcgctagctcaattcgatcaattgcataagcgcggtatggcc
atttacggcggttccaatgaagcggccactggctatgcgttgatttccatggcgcgcagc
atgccgaacaaggcagaggctacggaaatgctggcaagagcgactggtcatcatgagttg
gcggcggcggcggccgggatggcgcgggacatgcagaacatccagcgggcggtggcaggc
gctggtgtggcgattgatccgtcagcgaccggatccgttccagatctcgtctcgcaggtt
ggcggtgccaccggagcgccgagtgcgggagcgacccaggcccaatatcaggcagatcat
ggtgcggctgcaagcaacgtcaacaactcgacaggcgccgccgactggaatccgtctgct
gtaactgggtttttccagggggcgcaaagcgatgtggctaaccacggtccaggtgccaaa
ttgctaaatcaggccatgggcatgtttggatccggagtcatgaccccacagcaggcgcag
caaggaatggggaaagaaaggggggcctacatagacaaggcggcgcggctaggatctgaa
gacccaaacctgacaagcctagcccttggcgccaccggacttggcggtatggccgctgcg
ttggcgcttggcggtgggctcaaaaaaatgatggggaacaaggcggcgcaagctgatctg
gaaaaggggatgagcccagaggaacagcaagccatgtctgaagcggctaatgagatggct
gatggcaaatcgttcggagatttaactgaggcgcagcaaggcgctgtcatgaaggcgact
gggaatctgaacagcgttgcaaacgcgaagataacgcaggaactcggcacgaaaacaatg
gattcctacaacagtggtgttgagaagatgctcaacggaaaagcaaatgagattacgcca
ggagaacgcgcatccattgccaaggttgcccaggcgcgacaggcaattaccgataaattg
gggctgtcgaaagcgccgtctggtggtgaagccgttgatagcgggggtgacggaattgcg
caggggaactctggtgcagaagaggcaaacgggcaggttcctggggagtctgtgggcgca
gatccgttggatccgggatcaccgccaagtgttcctgtagaaaaaaccgtggttccaatg
ttccctgggcaagacggataccagggcccgtcaaatagccccggatcgaaagaataa

DBGET integrated database retrieval system