KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1097
Entry
AFE_1097          CDS       T00810                                 
Name
(GenBank) conjugal transfer protein TraN, putative
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
SSDB
Motif
Pfam: TraN Cellsynth_D
Other DBs
NCBI-ProteinID: ACK79963
UniProt: B7J845
Position
988768..991827
AA seq 1019 aa
MGFFIWMGHPKRQRRAGALFIAWMAALGVIYEATATANAGTFINQAQSGADLGNTLLLGG
QTDAAGNAGGQEMQGFAGTQPAGVENNASSYYLSDNVGLTPGNALNQASAANTAVLSDPT
CPSGWPGPLNQFQQQGMGAVASTQNACKGPLQAAATSLTQAMAGTSGSTLAAYQGAQQSI
QTFGQELSQVNSAGNALETTCAPVINGYYQYAPACNLLSVSGVPSLGTLAAAWAGPLGTV
ASGCAALPTAITSPAAAQSLENALAPLTADLQGIIGGATGSVYANGNGDGAAILTGGYGS
GAVTAASQEYQQIYGQCSYAQSYLENISTYPGGMNAYASDPMLNNFLSNPANQGMINQMM
PFIESNPNVFSQYYQNVACTNNNVNITNAGTSATGPSTTTTSAPSIQSSPVACTEPLSAY
TSTGWIDAADWPDPNAQWIYGTAGGCGAGVPNGTTDLMEGVYSNTTGAPLNATLYLAADD
EGVVDINGTQVATYSDGGQGGDGAAAYPSTGGVVSVPITLSPGPDQIMYYITNAGGGTAA
NPSSGILTIIGTVNGTSQVLIDTNSNWVYVPQNAAQAGSTVTVNPGSVTTNTTPNTHAQS
ILCNSPIQCMGTECHALFGNQDLQFSQALTALSALQQMEQGAVCATGTSMAAGNCQPIIF
GGTADYCRTWPAGGVFTNNCCAQGLQDAGQSGNLASYLELAHDTWKIANAPIVDAHVWGM
KAFHSWVEGAYSTMDQWAAQGWGYVVTAFRGAADAVAQAFGQVGPYAFHDCGILSNSVFT
SPPATKGLETAMENEIKGWLETAAKWVLKKIFGKAIEKEVMTFLASKIAEKIGSYAADAA
SIIGWVYLAYQVLQIIGNLLTACKNEEFKLGQKRKLHACQNLGTYCTDKFLGFCLEHKDV
FCCYASPLSRIIAAQIKIGQPNVAGGYGTPQDPQCGGFTVQQLAAVDWSEVSLAQWQALL
QSAGLIAGGNAQGSAIYTPAQIDHPGGDVNIEQAPIPVGHSGTPVTPVPMPTINPNASP
NT seq 3060 nt   +upstreamnt  +downstreamnt
atgggctttttcatctggatggggcaccccaaacgccagcgccgcgccggcgcgttgttc
atcgcctggatggcggcgttgggggtcatttacgaggctaccgcaaccgccaatgccggt
acgttcatcaaccaagcgcaaagcggagcggatctcggcaacactttgcttctgggcgga
caaaccgatgccgccggcaatgccggtggtcaggagatgcaaggtttcgccggcactcag
ccagcgggtgtggagaataacgcttcttcctattacctgtcggacaatgtggggctgacg
ccagggaacgcgctcaatcaggccagcgccgccaacacggcggttttgagtgatccgact
tgtccctctggttggccgggaccgctcaatcagttccagcagcagggcatgggtgcggtg
gcctccacccagaacgcctgcaaaggccccttgcaggccgcagcgacctccctgacgcaa
gctatggccggaaccagtggaagcacgctggcggcatatcagggcgctcaacaatccatc
cagacgtttgggcaggaacttagccaggtcaacagcgcgggcaacgccctggaaaccacc
tgcgcgccggtgatcaacgggtactatcaatacgcgccagcctgcaacctcttgagcgtg
tccggggtgccttccttggggacgctggccgccgcctgggcggggccgctgggtaccgtg
gcgtccgggtgcgcggcgctgcccacggccatcaccagccctgcggcggcgcagagcctg
gagaacgcactggcgccgctgaccgcagacctgcaagggatcatcggcggcgcgacggga
agcgtctacgccaatggcaatggagatggtgcggccatcttgaccggggggtatgggagc
ggcgccgtcacggcagcgtcccaggagtaccagcagatatacgggcaatgcagctatgcc
caatcctatctggaaaacatctccacctacccgggcggcatgaacgcctatgccagcgac
ccgatgctcaacaacttcctgagcaatccggcgaatcagggcatgatcaaccagatgatg
ccttttatcgagagcaaccccaacgtcttcagccagtattaccagaacgtcgcctgcaca
aacaacaacgtcaacattaccaatgccgggacatccgcgacagggcctagcacgaccacg
accagcgcgccgtcgatccagtccagtccggtcgcctgtacggaaccgctctcggcttat
accagtaccggctggatcgatgccgctgactggcctgaccccaatgcacaatggatctac
ggaacagccggaggatgcggggccggagtgcccaacggcacgacggatctcatggaggga
gtgtattccaataccacgggcgcgcccttgaacgccacgctgtacctggcggccgacgat
gaaggtgtagtggacatcaacggcacgcaggtggcgacctactcggatggggggcaaggc
ggcgatggagcggcggcctatccttcgaccggaggtgtggtttccgtgccgatcacgctg
agtccggggccggaccagatcatgtactacatcaccaatgctggtggcggcacggcggcc
aatccatcatcgggcatcctcaccatcatcggcaccgtgaacggcaccagtcaggtgctg
atcgacaccaacagcaattgggtctatgtaccgcaaaacgcggcgcaagcggggtcaacc
gtcaccgtcaaccccgggtccgtgacgaccaacaccacgccgaacacgcatgcccagagc
atcctgtgcaatagcccgatccaatgcatgggcacggaatgccacgccctgttcggcaac
caggacctgcaattcagccaggcgctcacggccctgtccgcgttgcaacaaatggagcag
ggggccgtctgcgcaaccggtacgtctatggcggcaggcaattgtcagccgatcattttt
ggcggtactgccgactattgccggacctggccggccggtggggtattcacgaataactgc
tgcgcacaagggttgcaggatgcagggcaatccggaaacttggcaagttaccttgagctc
gctcacgacacatggaagatcgccaatgcaccgattgtagatgcgcatgtctggggtatg
aaagcattccatagttgggtggaaggcgcctacagcaccatggatcaatgggcggctcaa
ggctggggttatgtggtcacagcttttaggggcgcggctgatgctgtggcgcaagccttt
ggtcaggttggaccatatgcgttccacgactgtggcatcctaagcaattcagtctttact
tcacctcctgctaccaaagggctggagactgcaatggagaacgaaataaagggatggtta
gaaactgctgcaaaatgggtattgaaaaagatttttgggaaagcaattgaaaaggaggta
atgacgttccttgcttcaaaaatagcagagaaaattggaagttatgctgcagacgccgcg
agtattataggatgggtttatttggcataccaagttttgcaaattattggtaatctcctg
accgcatgcaaaaacgaagagtttaaactcggacagaagcgcaaactccatgcttgccag
aatctggggacctattgcacggataaatttttgggcttctgtctggagcacaaggacgtg
ttctgctgctacgcgagtccgctttcacggattattgcggcgcaaatcaagatcggtcag
cccaacgtcgccgggggttatggcaccccccaggatccccagtgcggcggattcacggtg
cagcagcttgcggcagtggactggtctgaggtttccttggcgcaatggcaagcattgctg
cagagcgcaggattgattgcggggggtaatgctcaaggatcagccatctatacgccggcg
caaatcgatcatccaggcggtgatgtaaatattgagcaggcaccgataccggttggccat
tctggcacgccggtaacaccagtgccaatgccaacgataaaccccaatgccagcccttga

DBGET integrated database retrieval system