KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1459Help
Entry
AFE_1459          CDS       T00810                                 

Gene name
lpxB
Definition
(GenBank) lipid A disaccharide synthase LpxB
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00540  Lipopolysaccharide biosynthesis
afr01100  Metabolic pathways
Module
afr_M00866  KDO2-lipid A biosynthesis, Raetz pathway, non-LpxL-LpxM type
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    AFE_1459 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:afr01003]
    AFE_1459 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:afr01005]
    AFE_1459 (lpxB)
Enzymes [BR:afr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     AFE_1459 (lpxB)
Glycosyltransferases [BR:afr01003]
 Polysaccharide
  Bacterial polysaccharide
   AFE_1459 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:afr01005]
 Lipid A
  AFE_1459 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB
Motif
Other DBs
NCBI-ProteinID: ACK79471
UniProt: B7JA36
Position
1260570..1261697
Genome map
AA seq 375 aa AA seqDB search
MGKAFILAVERSGENLGLEILANAAQAGLDLQWSGVVGSRLQAAGVQNIANGEVLAMIGL
VEVLRHYGRLRRLYGQIRQHLQAERPACVVLIDHPAFNLHVAKMAKQMGIRVLYVVGPQI
WAWRSQRIHQIKRVVDHMLVLFPFEVPIYAQAGVPVHVLAHPLLAQTATAQDGMDARAAL
GLTAGGPVLALLPGSRRGELERLTLRYAETARRLRKQIPDLRILVALAREELRPLWERLW
KQGAGPEDAQLVVAQTQTVLAAADVVLVASGTATLETALMRRPAVVVYILNALTFAFVRR
LVKTPFVAMPNILLQEAVYPEFLQEAFEPAQVADALAALLGPAGSEQVAKLQKLRSLLEG
NPPEQLQQVLREMLA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgggcaaggcctttatcctcgcggtagagcgttccggcgaaaatctcgggctggaaatt
ttggcgaatgccgcgcaggcgggacttgatctgcaatggtccggggtggtcggatcccgt
ctgcaggcggcgggcgtgcaaaatattgccaatggtgaagtgctggcgatgatcgggttg
gtcgaagtcttgcggcactacggtcgcttgcgcaggctttatgggcaaatccggcagcat
ctgcaggcggaacggccggcttgcgtggtgctgattgatcatcctgctttcaatctgcac
gttgccaagatggccaagcagatgggcattcgagtgctctatgtggtgggtccccagatc
tgggcctggcgctcgcagcgaatccaccagatcaagcgcgtagtggaccacatgctggtg
ctttttccttttgaggtgcccatttatgcacaggcgggggtgccggtgcatgtgctggcc
catcccttgctggcgcagactgcgacggcgcaggacggaatggatgcgcgggcggcactg
ggactgacggcaggggggccggtgcttgcgctcctgccgggcagtcgccgcggcgagctg
gaacgtctgactctacgctatgcggaaacggcgcgacgtttgcgcaaacaaataccggat
ctgcggattctggtggccttggccagggaggagttgcgccccctctgggagcggctctgg
aaacagggtgcggggccggaagatgcgcagttggtggtcgctcagacgcaaaccgtgctg
gcagccgctgacgtggtgctggtcgcctccggtaccgccacactggaaacggcactcatg
cggcgcccggcggtcgtcgtctatattttgaacgcactcacctttgctttcgtccgaaga
ctggtgaagacccccttcgtggccatgcccaatattttgctccaagaggccgtatacccg
gaattcctccaggaggccttcgagcccgcccaagtggctgatgcactggcggcgcttttg
ggtccggcgggttccgagcaggtggcaaaattgcagaaactgcgcagcctgctggaaggc
aatcctcccgagcagttgcagcaagtgctccgggagatgctggcatga

DBGET integrated database retrieval system