KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1638
Entry
AFE_1638          CDS       T00810                                 
Name
(GenBank) conjugal transfer protein trbE, putative
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:afr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AFE_1638
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afr02044]
    AFE_1638
Enzymes [BR:afr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     AFE_1638
Secretion system [BR:afr02044]
 Type IV secretion system
  Trb secretion system protein
   AFE_1638
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 DUF87 AAA_29 ABC_tran MinC_N AAA_16 Zot CbiA
Other DBs
NCBI-ProteinID: ACK79653
UniProt: B7JAX7
Position
1409555..1412077
AA seq 840 aa
MRSLKQYRDQALGLPDLLNIAFLVDGWQTDAGEMAIALQKDGSFLAGFRYDGPDLESQST
QDLEALSATWNNAIARLGTDWGVHVTAIREPADGYIDESECAFRDPVSRLIEAERRAQFG
SETHHYVSRYYLTVAWRTPIDAEVQLVQSMIQKKAGKQPGQLADAAFRDTLARYRQVIEV
ILGIFRHGYRVKAMDADALLTHIHECLTGATHRVNAPRIPAYLDALIGHHDFVGGLEPSM
DGEEIRVVTVLGYPSMTFPEMLENLHSLPIPLRYTLRFLPLDPPDAVADMAKIRDRWFGS
RANMKSLLTEKMTGEAQGQLSADDTVVNLAYDAKQAVNEAREGAVKFGNFTLSVVLRSAD
EKVLADRIKAIKTFFDNAGYVAHLETTNTVEAFLGSIPGHLYENIRRPLMHSLNVADFAP
KTEIWAGEARCPSPLMNLSDGRKAPPLLYAATTGNTPFRLNLHVGDLGHSLIAGMTGGGK
STLLALLAAQWQRYPDSRVIAFDKGMSLYALTEAMGGQHYDLNGPTSDLFFAPLQHVDDP
AEAAFAADWVEALATLQGMTITSTERSAIRDAVHGLARESGRSLTALVQMIQNRGIKDAL
QYYTLTGQTGKLLDAESDGLSMADASMITFEMSHLMNGGPAEHRVTVPVLLYLFHRIEQM
LDGRPTLILLDEAWTFLDNELFLAKLRQWLKELRKKNAAVVFATQSLNDLKNSPLLPVLK
ESCPTKIFLPNRAATSPDLRPLYIDMGLNDRQIDLVAASTPKQDYYLSTPECQRRIQFGM
GPVTLAFCGVSDPREVKRVVELKTQHGDRWPIAWLKERLSPSIRDGWVSYAESLYQGERA
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgcgctccctgaaacagtaccgcgatcaggccctgggtcttcccgatctgttgaacatc
gcttttctggtggatggctggcagacggatgccggggaaatggccatcgcgctgcaaaaa
gacgggagctttctggcggggttccgctatgacgggcctgatctcgaaagccagtccacg
caggatctggaggcgctctcggccacctggaataacgccatcgcccggctgggcacggac
tggggcgtgcatgtcacggcgattcgcgagccggccgacggctatatcgacgaatcggag
tgcgcctttcgcgacccggtgtcgcgcctcatcgaggccgagaggcgggcgcagtttgga
tcggaaacccatcactatgtcagccgctattaccttacagttgcctggcgaacgcccatt
gatgcggaagtgcagttggtacagtccatgatccaaaagaaagccggtaaacaacccggg
cagctggccgatgcggcattccgggacacgctggcccgctaccggcaggtgattgaagtt
atcctgggcattttcaggcacggataccgggtgaaggccatggatgccgacgccctgctg
acccatatccatgagtgcctgaccggcgccacgcatcgcgtcaatgcgccccggattccg
gcgtatctggatgccctcatcgggcaccatgattttgtgggcggtctggagccgtccatg
gacggggaagagattcgcgtcgtaacggttctgggctatcccagcatgaccttccccgag
atgctggagaacctgcatagcctgcccattcccctacgctacacgctccgcttcctgccc
cttgatccgccggatgcggtggcggacatggcgaagatccgggatcgctggtttggctcc
cgggccaacatgaaatccctgcttacggagaagatgacgggcgaagcccagggacagttg
tccgccgacgatacggtggtgaacctcgcctatgacgccaagcaggccgtcaatgaggcg
cgggagggcgctgtgaagtttggcaacttcacgctatccgtcgtgctgcgttccgccgat
gaaaaagtgctcgcggaccggatcaaggcgatcaagaccttcttcgacaatgccggctat
gtcgcccacctggaaacgaccaatacggtagaagcgttcctgggcagcatcccgggtcat
ctctatgagaacatccgccggccactgatgcactcgctgaatgttgcggatttcgcgccc
aagacggaaatctgggccggtgaagcgcgttgcccgagtccgctgatgaatctgtctgac
ggccgcaaagctccgcccctgctgtacgcggcgaccacgggaaatacgcccttccgactg
aatctccatgtcggcgatctggggcacagcctgattgccggcatgaccgggggcggaaag
agtacgctcctggccctgttggccgcgcaatggcaacgttatcccgacagccgggtgatt
gccttcgacaagggcatgagtctctacgccctcacggaagccatgggtgggcagcattat
gatctgaacggcccgacctccgatctgttttttgcacccctgcagcacgtcgatgatccg
gccgaggcggcttttgcggccgactgggtggaagcgttggccaccttgcagggcatgacg
atcacctctacggagcgttcggccattcgtgacgctgtgcatggcctggcccgggaatcc
gggcgctcgctcacggcgctggtccagatgatccagaaccgggggatcaaggatgccttg
cagtattacaccctgaccgggcaaacggggaagctgcttgatgccgagagtgacgggctg
tcgatggccgatgccagcatgatcactttcgagatgagtcacctgatgaacggcggcccg
gcggagcaccgggtaacggttccggtactgctgtatctgttccaccggatcgaacagatg
ctggatggacggcccaccctcattttgctcgatgaggcctggaccttcctggacaacgag
ctgtttctggcgaagttgcggcaatggctgaaggaactgcggaagaagaatgccgccgtc
gtttttgccacacagtccctgaatgatctcaagaacagccccttgctcccggtcctgaag
gagtcctgcccgacgaaaatcttcctgcccaaccgggctgccaccagtccggatctcaga
cccctgtatatcgacatggggctgaatgatcggcaaatcgatctggtggcggcgtccacg
ccgaagcaggactactacctgtccacacccgaatgtcagcgccggattcagtttggcatg
gggccggtcaccctggctttttgcggtgtctccgatccacgtgaggtcaagcgggtagtg
gagctcaagacgcagcacggcgatcgatggccgatcgcctggctgaaagagcggctgtca
cccagcatccgggatggctgggtgagctatgcggagtccctttaccagggagaacgggca
tga

DBGET integrated database retrieval system