KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1877Help
Entry
AFE_1877          CDS       T00810                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00670  One carbon pool by folate
afr01100  Metabolic pathways
afr01120  Microbial metabolism in diverse environments
afr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AFE_1877 (folD)
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     AFE_1877 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     AFE_1877 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH adh_short
Motif
Other DBs
NCBI-ProteinID: ACK79087
UniProt: B7JBX9
Position
complement(1631187..1632053)
Genome map
AA seq 288 aa AA seqDB search
MTARRIDGKAIAQKIHADISLRSHAFLRQWGRSPGLAVVLVGADPASRIYVQKKRETCAS
VGIASFSANLPADTNPQQLLAHIGELNVNDAVDGILVQLPLPPHFDPEEIIEAIAVEKDV
DGFHPYNIGRLALRAPLLRSCTPAGIMTLLQESGIDIKGKEAVIVGASNIVGRPMALELL
LAGATVTVCHRFTRDLAAHVGRAELLVAAAGKPGLISGAWIREGAVVIDVGINRLPDGRV
TGDVDFAGAEQRAAWITPVPGGVGPMTVATLLQNTLIAAEHRMGAPHV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcacgacgcattgatggcaaagccatcgcgcaaaaaatacatgccgatatttcc
cttcgcagccatgcctttctccgccaatgggggcgctcccccggccttgcggtagtactg
gtcggcgctgatccggcctcccggatttatgtacagaaaaagcgggagacctgtgcttcg
gtgggaattgcctcattctccgccaatttgccagcagacactaatccacaacaacttctg
gcccatattggggagctgaatgtcaatgacgcagtcgacggcatcctggtgcaactgcca
ctccctccccattttgatccggaagaaatcatcgaagccatcgcggtggaaaaagacgtg
gatggtttccacccctacaatattggccgtctcgccttgcgcgcgccattgcttcgctcc
tgcacacctgcgggcatcatgaccctccttcaggaatctggcatcgatatcaagggaaaa
gaggcggtaatcgttggtgcctccaatatcgtcgggcgccccatggcattggaacttctc
ctcgccggcgcaacggtgaccgtctgtcatcgctttacccgggacctggcggctcatgta
gggcgcgccgaactgctggttgcggcggccggcaaaccggggttgatctctggtgcgtgg
attcgtgagggcgcggtggtgatcgatgtaggaatcaaccgtcttccggatgggcgggtg
accggcgacgtggactttgccggcgcagagcagcgtgcggcgtggatcaccccggtcccc
ggcggggtcggacccatgactgtggctacccttctgcagaacaccctgatcgccgcggag
caccgcatgggggcaccgcatgtctga

DBGET integrated database retrieval system