KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1910Help
Entry
AFE_1910          CDS       T00810                                 

Gene name
fabF
Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00061  Fatty acid biosynthesis
afr00780  Biotin metabolism
afr01100  Metabolic pathways
afr01212  Fatty acid metabolism
Module
afr_M00083  Fatty acid biosynthesis, elongation
afr_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AFE_1910 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AFE_1910 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:afr01004]
    AFE_1910 (fabF)
Enzymes [BR:afr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     AFE_1910 (fabF)
Lipid biosynthesis proteins [BR:afr01004]
 Fatty acid synthase
  Component type
   AFE_1910 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: ACK80496
UniProt: B7JC11
Position
1665604..1666845
Genome map
AA seq 413 aa AA seqDB search
MKRRVVITGLGIVSPVGVGIPAAWNSITQGRSGIGRVTRLDPASYSSQIAGEVRGFDIGQ
YIPIKEARKMDLFIHYGLVAAMEAVADSGLQIGADIADRVGVSIGSGIGGLPGIESEHQV
VTESGPRRISPFFIPRCIVNMVSGHVSIMYGAKGPNIAMATACSTGTHSIGEAARLIEYG
DADVMIAGGAEAAVSPLGLGGFCAARALSTRNADPEKASRPWDKDRDGFVLGEGAGVLIL
EEYEFARRRGARIYAELAGYGMSSDAYHMTQPAPGGEGAVRCMQAALRNASVSPEMVGYI
NAHGTSTPLGDRSETDAVHTVFGEHAQRLAMSSTKSMTGHLLGAAGGVEAIFTALALYHG
ILPPTINLDQADEGCDLDYVPLKARKASVEVALSNSFGFGGTNSSLVFRRFHD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttgaagagacgtgtagtgattacgggtttggggattgtgtcacccgtcggtgtgggtatc
ccggcggcgtggaattcgataacccagggacgcagcggtatcggtcgggtgacccgactg
gatcctgcctcctacagttcccagattgcaggagaagtccgtggcttcgatattggtcag
tacattccgatcaaggaagcccgcaagatggatttatttatccattacggcctcgtggcg
gctatggaagcggttgcagactctggtttacagatcggagcagatattgcagatcgggtg
ggcgtatccatcggcagtggtatcggtggtctgccgggcatcgaatccgagcatcaggtc
gtcacggaaagcggcccccgccggatctcgcctttctttattccacgttgcatcgtcaat
atggtgtcggggcacgtttccattatgtatggggccaaagggcccaacatcgccatggcg
acggcatgttccaccggcacacattccatcggcgaggcggcgcggctcatcgagtatggc
gacgccgacgtcatgatcgccggtggtgccgaggcggccgtcagccctttggggttgggt
gggttttgtgcggcgcgggcgctctctacgcgcaacgccgatcctgagaaggcgagccgc
ccctgggataaggatcgggatggtttcgtgctgggcgagggtgcgggtgttctcattctc
gaagagtatgaatttgcccggcgtcgtggggcacggatctacgcagagttggccggctac
ggcatgagctccgatgcttaccatatgacccagcccgccccgggtggggaaggggccgtc
cgttgcatgcaggccgcgctgcgtaacgcctcggtgtcgcccgaaatggtgggttatatc
aacgcgcacgggacatctaccccgctgggagatcggtcggagaccgatgcggtacatacc
gtattcggcgaacatgcacagcgattggccatgagctccaccaagtcgatgacaggtcat
cttctgggtgccgcggggggggtcgaagccatttttacggcgctcgcgctttatcacggc
attttgccgcccacgatcaatctggatcaggccgacgagggctgtgacctggattatgtg
cccctcaaagcacgaaaagcgtccgtagaagttgctttaagcaattcctttggattcggc
ggcaccaatagttctctggttttccgccgcttccacgactga

DBGET integrated database retrieval system