KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2069Help
Entry
AFE_2069          CDS       T00810                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00260  Glycine, serine and threonine metabolism
afr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01130  Biosynthesis of antibiotics
afr01230  Biosynthesis of amino acids
Module
afr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFE_2069 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AFE_2069 (trpB)
Enzymes [BR:afr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AFE_2069 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ABC_membrane
Motif
Other DBs
NCBI-ProteinID: ACK77930
UniProt: B7J4S9
Position
complement(1818778..1819977)
Genome map
AA seq 399 aa AA seqDB search
MGTYALPDAFGHYGPYGGRFVAETLIPALEELERAYQEAQRDPEFRAELHSELRQFVGRP
NPLYHAGRLSRELGGAQIYLKREDLNHTGAHKINNAVGQALLARRMGKKRVIAETGAGQH
GVATATVATRYGMECLVYMGEEDIQRQSSNVFRMRLLGAQVTAVSSGTRTLKDALNEALR
DWVTNVESTFYVIGTVAGPHPYPVMVRDFHRVIGDEARAQCLELTGRLPDCLIACVGGGS
NAIGLFYPFIEDRAVRMIGVEAGGLGLGTGQHAAPLTTGRPGVLHGNRTYLMEDEDGQIL
PTHSISAGLDYPGVGPEHAYLKDTGRAEYVAATDEEALAAFHRLCRTEGIIPALESAHAL
AHAFRLAPTMRSDQTIIVNLSGRGDKDIHTVAALEGIHL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgggaacttatgctttgccggacgcgttcggacactatggtccttacggcgggcgtttc
gttgcagaaaccctgattccggcgctggaggaactggagcgtgcctaccaggaggcgcag
cgggatccggagtttcgtgccgagctgcacagtgaactgcgccagttcgtcggtcgtccc
aatccactctatcatgccgggcgcctttccagggagttgggtggagcgcaaatttacctc
aagcgggaggacctcaaccacaccggcgcgcacaaaatcaataatgccgtgggtcaggcg
ctgctcgcccggcgtatgggcaaaaaacgggtaatcgccgagacgggcgcggggcagcat
ggtgtcgccacggcgacggtcgcgacccgctatggcatggaatgcctggtgtatatgggc
gaggaagatatccagcgccagtccagcaatgtgtttcgcatgcgtttgctgggggcgcag
gtgacggcggtcagcagcggtacccgcaccctgaaggatgcgctcaacgaagctttgcgg
gactgggtaaccaatgtcgaaagcactttttatgtgatcggaacggtggcgggaccgcat
ccctatccggtcatggtgcgggactttcaccgggtcattggcgatgaagcgcgggcgcag
tgcctcgaattgacgggacggctccccgattgtctgatcgcctgcgtggggggggggagt
aatgccattggcctgttttatccctttatcgaagaccgggcggtgcggatgatcggcgtc
gaagcgggtggtctgggccttggcaccggacaacacgccgcccccctgaccaccggacgt
ccaggggtattgcatggtaaccggacctacctgatggaagacgaagacgggcagattctg
ccgacccactccatctcggcggggctggattatccgggggtgggaccagagcatgcctat
ctgaaggataccggtcgggcagagtatgtggcggctaccgatgaagaagcgctggccgcc
ttccatcgcctgtgccgcaccgagggcatcattccggcgctggaaagcgcacatgcgctg
gctcacgccttccgcctggcgcccaccatgcgctctgatcagaccattatcgtcaacctt
tccgggcgaggcgataaggatatccacaccgtcgccgccctggagggtattcatttatga

DBGET integrated database retrieval system