KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2580Help
Entry
AFE_2580          CDS       T00810                                 

Gene name
glyQ
Definition
(GenBank) glycyl-tRNA synthetase, alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:afr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AFE_2580 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:afr01007]
    AFE_2580 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:afr03016]
    AFE_2580 (glyQ)
Enzymes [BR:afr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     AFE_2580 (glyQ)
Amino acid related enzymes [BR:afr01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   AFE_2580 (glyQ)
Transfer RNA biogenesis [BR:afr03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AFE_2580 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: ACK80442
UniProt: B7J7P7
Position
2292536..2293420
Genome map
AA seq 294 aa AA seqDB search
MTFQEIIQRLQGFWADQGCVLLQPMDMPVGAGTFHPATFLRAIGPEPWRAAYVQPSRRPT
DGRYGDNPNRLQHYYQFQAVLKPNPVNLQELYLESLAALGIDSGVQDIRFVEDDWESPTL
GAWGLGWEVWLNGMEVTQFTYFQQVGGLDCHPVMGEVTYGLERLAMYLQGVESVYDLVWT
PNVLYGDVFHQNEVEQSRYNFELAPVEDLFQRFDQAEKDCHALLAAELPLPAYERVLDCS
HTFNLLDARHAIGVNERARFIGRVRTLARGVAEHYADARAALGHPLLRSQDVSA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcaggaaatcatccagcggctgcaaggcttctgggccgatcaaggctgtgtt
ctgctccagcccatggatatgccggtaggtgccggaaccttccaccccgccacctttttg
cgggccatcggcccagaaccatggcgggctgcttacgtacagccctccaggcgtcccacg
gacggccgttatggggacaatcccaatcgtctccagcactactaccagtttcaggcggtg
ctcaaaccaaacccggtgaacctgcaggaactctacctcgaatcgctggcggccctcggt
attgattccggggtccaggatatccgtttcgtcgaagacgactgggagtccccaaccctg
ggggcctgggggctgggctgggaggtctggctgaatggcatggaagtcacccagttcact
tatttccagcaggtgggcggtctggattgccatcccgtgatgggcgaggtcacctatggt
ctggaacgactggccatgtacctgcagggcgtcgaaagcgtctatgaccttgtgtggacc
ccgaacgtactctacggggacgtattccatcagaacgaagtggaacaatcgcgctataat
tttgaactggcgcccgtggaagacctctttcagcgcttcgaccaggcggaaaaagactgt
cacgcattgctggcagccgaactccctttacccgcctacgaacgggtgctggactgctcc
catacctttaacctgctggacgcacgccatgccatcggcgtcaacgagcgcgctcgattc
atcggccgcgtccgtacgcttgcgcgaggtgtggccgagcactacgccgacgcccgtgcc
gccctcggccaccccctgctgaggagccaagatgtcagcgcctga

DBGET integrated database retrieval system