KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2933Help
Entry
AFE_2933          CDS       T00810                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:afr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AFE_2933 (recD)
Enzymes [BR:afr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AFE_2933 (recD)
DNA repair and recombination proteins [BR:afr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AFE_2933 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 PhoH AAA_22 UvrD-helicase AAA_24 PIF1 DUF2075 AAA_5 UvrD_C Mg_chelatase ResIII AAA_28 ATPase AAA_16
Motif
Other DBs
NCBI-ProteinID: ACK78241
UniProt: B7J9Q7
Position
2617837..2619777
Genome map
AA seq 646 aa AA seqDB search
MTSLMIDQLRAWTSAGWLRPLDLAFAQFLIRLDPQAPALLPLAGALLARLEGEGHTCIAL
EDFLGAPERFLDWPAPGHAMLATALGDWPHAAQWTETLARSRCVQVTERNAPVPANGAET
PLVLSAARLYLRRYWRDQQFIAEALRQRAQQRVADAANPEALRPWLEQLFPASDEPGDAL
PWQKIACALALRSHFSIITGGPGTGKTYTAARFMALLMATSSTPLRIVLAAPTGKAAVRI
DESLQSAVGTLPQLSQIPDMTAAFARLRPARTLHSLLGARPDSRRFRHDAANPLELDVLV
VDEASMIHQEMMAALLRALPPAARLILLGDQDQLASVEAGAVLAELSLGSGKYDAETCHY
MQASCGAAPRPGDNGPSPLAANIIRLQRSHRFNAEIGALADAVHGGHPETAVRILQTAHT
GTLAWQPAPAIHRILELARPESAYGRVWQAAGQPPPKDRQQHSAWVKTILNDYAGFRILC
ALRQGPWGVTGINRAIEDYLQRQGILQSRGLWYAGRPTLVTRNDPNLGLSNGDIGIALPD
PDKRLRVYFPNSEEAPRAILPSRLNHTESAWAMTVHKAQGSEFAHTVLILPPEDSPVLSR
ELLYTAITRARKCFTLIAPRERLENAIQRQTRRMSGLHAALYDPRR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctcatgatcgaccaactccgcgcctggaccagcgccggctggctacggccc
ctcgaccttgccttcgcgcagttcctcatccgcctggacccgcaggccccggccctcctg
cccctggcgggcgctctcctcgcccggctggagggagaaggccacacctgcatcgcgctg
gaagacttcctcggcgcacccgaacgcttcctggactggcctgcgccggggcacgccatg
ctggcaaccgcactcggtgactggccccatgccgcccaatggacagaaaccctcgcccgg
agccgctgcgtacaggtcaccgagcgcaacgcccccgtcccggcaaacggcgcagaaacg
cccctggtcctcagtgccgcccgcctctatttgcgccgctactggcgtgaccagcaattc
atcgccgaggccctgcgccagcgcgcccaacagcgcgtcgccgatgccgccaaccccgag
gcattaagaccctggctggagcaacttttcccggcgtctgacgaacccggcgacgcactc
ccctggcaaaaaatcgcctgcgccctcgccctgcgcagccacttcagcatcatcaccggc
ggccccggtaccggcaaaacctacaccgcagctcgcttcatggccttgctcatggcgacc
agcagcacacccctgcgcatcgtgcttgccgcccccaccggcaaggccgccgtgcgcatc
gacgaatccctgcagagcgcggtcggcactcttccgcaattgagccaaatacccgatatg
actgccgccttcgcccgcctgcgtccggcgcgcaccctgcacagcctgctcggcgcccgc
cccgacagtcgtcgctttcgccacgatgctgccaaccccctcgaactggacgtactcgtg
gtggacgaagcctccatgattcatcaggagatgatggccgccctgctccgcgccctgccg
cctgcggcccgcctcatcctcctcggcgatcaggaccagcttgcctccgtcgaagcgggc
gcggtgctggccgaactcagtctcggcagcggtaaatatgatgccgagacctgccactat
atgcaggccagttgcggtgccgcgccgcggcccggcgacaacggccccagcccccttgcc
gcaaacatcatccgcctgcaacgcagccatcgcttcaatgcagaaatcggcgcgctggcg
gatgccgtgcatggcggccaccccgaaaccgccgtccgcatcctgcaaacggcgcacact
ggcactctcgcctggcaacccgcccctgccatccaccggatactggaactggcccgcccg
gaaagcgcctatggtcgggtctggcaagccgcgggccagccgccacccaaagaccggcaa
caacatagcgcatgggttaaaaccatcctcaacgactacgctggcttccgcatcctctgt
gccctgcgccaaggcccctggggcgttaccggcatcaaccgcgccatcgaagactacctg
cagcgccagggcatcctgcagagccgcggcctttggtatgccggccgccccaccctcgtc
acccgcaatgaccccaacctcggtctcagcaatggcgacatcggcatcgccctgcccgac
ccggataaacgcctgcgcgtctacttccccaatagcgaagaggccccccgcgccatcctc
cccagccgcctcaaccacaccgaaagcgcctgggccatgaccgtccacaaggcacagggt
tccgagttcgcccacaccgtcctcatccttcctccggaagacagccccgtcctcagccgc
gaactgctctacacggccatcacccgcgcccgcaaatgcttcaccctcatcgccccccgg
gagcgactggaaaacgccattcagcgccagacgcggaggatgagcggattacacgcggcg
ttatatgatcccaggcgctga

DBGET integrated database retrieval system