KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2970Help
Entry
AFE_2970          CDS       T00810                                 

Gene name
cysD-1
Definition
(GenBank) sulfate adenylyltransferase, small subunit
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00230  Purine metabolism
afr00261  Monobactam biosynthesis
afr00450  Selenocompound metabolism
afr00920  Sulfur metabolism
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01120  Microbial metabolism in diverse environments
afr01130  Biosynthesis of antibiotics
Module
afr_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AFE_2970 (cysD-1)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AFE_2970 (cysD-1)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AFE_2970 (cysD-1)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    AFE_2970 (cysD-1)
Enzymes [BR:afr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     AFE_2970 (cysD-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct DUF3670
Motif
Other DBs
NCBI-ProteinID: ACK79126
UniProt: B7J9U3
Position
2658831..2659712
Genome map
AA seq 293 aa AA seqDB search
MNTLEAESLGILREAVAEARKPVMLYSIGKDSSVMLHLARKAFAPGPLPFPLLHVDTGWK
FREMIAHRDRMARELGAELIVHSNEEAMTAGINPFDHGASYTDIMKTQALKQVLDAHGFD
VIFGGARRDEEKSRAKERIFSVRESGHRWEPKNQRPELWSLYNTRLNPGQTLRVFPLSNW
TEADIWQYIAQEGIPLVPLYLAKERPVVQRDGQWIMVDDERLPLAPGEVPEMRRVRFRTL
GCYPLTAAVESDADTLEAVIAETLAARSSERAGRLIDHDSSGSMERKKQEGYF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgctcgaagccgaatccctcggaatcctgcgcgaagccgtagccgaggcgcgc
aagccggtgatgctgtattccatcggcaaggattcctcggtaatgctgcacctggcgcgc
aaggcctttgcgccgggtccgctgccctttccgttgctgcatgtggacaccggctggaag
ttccgtgaaatgatcgcccaccgcgaccgcatggcgcgagagttgggggcggaactgatc
gtacacagcaacgaggaagcgatgacggcgggtatcaaccccttcgatcacggggccagc
tataccgacatcatgaagacccaagcgttgaagcaggtcttggatgcgcacggcttcgac
gtgatcttcggcggcgcccggcgtgacgaggaaaagtcccgcgccaaggaacgtatcttt
tccgtgcgcgaatccggtcaccgctgggagccgaaaaaccagcgtccggagctctggtct
ctatataatacccggctgaaccccgggcagacgctgcgggtcttccccctgtccaactgg
accgaggccgacatctggcagtatatcgcgcaggaaggaataccccttgtgccgttgtac
ttggccaaggagcgcccagtcgtgcagcgcgatggccaatggatcatggtggatgacgaa
cgtctgccgctggcgccgggcgaggtgcccgagatgcgcagggtgcgcttccgcaccctg
ggctgctatcccctcaccgccgctgtcgaaagcgatgccgataccctggaggcggtgatc
gccgaaaccctggccgcacgcagctccgagcgcgccgggcggctgatcgaccatgacagc
tccggctccatggaacgcaagaagcaggagggctatttctga

KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2971Help
Entry
AFE_2971          CDS       T00810                                 

Gene name
cysNC
Definition
(GenBank) sulfate adenylate transferase, large subunit/adenylylsulfate kinase
  KO
K00955  bifunctional enzyme CysN/CysC [EC:2.7.7.4 2.7.1.25]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00230  Purine metabolism
afr00261  Monobactam biosynthesis
afr00450  Selenocompound metabolism
afr00920  Sulfur metabolism
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01120  Microbial metabolism in diverse environments
afr01130  Biosynthesis of antibiotics
Module
afr_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AFE_2971 (cysNC)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AFE_2971 (cysNC)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AFE_2971 (cysNC)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    AFE_2971 (cysNC)
Enzymes [BR:afr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     AFE_2971 (cysNC)
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     AFE_2971 (cysNC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APS_kinase GTP_EFTU MMR_HSR1 AAA_33 GTP_EFTU_D2 AAA_16 RsgA_GTPase AAA_18 GTP_EFTU_D3 ABC_tran Zeta_toxin KTI12 AAA_29 AAA_22 Thymidylate_kin ATP_bind_1 SRP54 RNA_helicase MeaB AAA_28 AAA_30 Ras PIF1 CLP1_P AAA_17
Motif
Other DBs
NCBI-ProteinID: ACK79592
UniProt: B7J9U4
Position
2659712..2661526
Genome map
AA seq 604 aa AA seqDB search
MNGRLRFLTCGSVDDGKSTLIGRLLFDTKQIFDDQFQALEKDSARFGTQGAAPDLALLVD
GLQAEREQGITIDVAYRFFATPERAFIVADTPGHEQYTRNMATGASTADAAVVLVDARKG
LLTQTRRHTRIVALMGVRQVVLAVNKMDLMDWSESAFRAIADEYAAFAQELGLTAVQSIP
LSALTGDNLTQSSTHTPWYGGPTLLQWLENVPAGLEEATPPLRLPVQLVLRPHAEFRGYC
GRIAQGTLRPGDAVRVLPSGVSSTVQQIFVGEQAQAQAQTGESVCITLADERDISRGDVL
CAVDAPLEMAEQFHAHLLWLHEQALIPGRPYWLQLHHRTVSATVSSIRHRIDPNSGAELA
ARELQMNDIAEVHLNLDRPLPFAPYAENRPLGAFILIDRLSNATVGAGMLDFALRRDHNL
HWQQLSVNKAARAALKHQPPRCVWFTGLSGSGKSTLANLLEKRLHAQGHHTYVLDGDNVR
HGLNRDLGFAEADRAENIRRVAEVARLMVDAGLIVLVSFISPYRAEREFARSLFTPGEFL
EVFVDTPLEECERRDPKGIYARARAGQIPNFTGISSPYELPLTPELRLSTPGSSPEALLE
PVLM
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtcgcttgcgttttcttacctgcggcagtgtcgacgatggcaagagtaccctc
atcggtcggctgctcttcgacaccaagcaaatcttcgacgaccaattccaagccctcgaa
aaagactccgcccgcttcggcacccagggtgctgcgcccgatttggccttgctggtggac
ggcttgcaagcggagcgtgagcagggcattaccatcgacgtggcctaccgtttcttcgcc
acgcccgagcgcgccttcatcgtcgccgacacgcccgggcatgagcaatacacccgcaac
atggccaccggcgcctccaccgccgatgcggccgtggtcctggtggatgcgcgcaagggg
ctgctgacccagacccgcaggcacacccgtatcgtggcgctgatgggggtgcggcaagtg
gtgttggccgtcaataagatggacctgatggactggagcgaaagtgccttccgcgccatt
gccgacgaatacgccgcctttgctcaagaactggggctcaccgccgtgcagtccattccc
ctttcggcgttgacgggcgacaacctcactcagtccagcacccacaccccctggtatggc
ggccccaccttgctgcagtggctggagaacgtgcccgctgggctggaggaggccacgccg
ccgctgcgcctgccggtgcaactggtgctacggccccatgccgagtttcgcggctattgc
gggcgcatcgcccaaggcacgctgcgccctggagacgcagtgcgtgtgctcccttcaggc
gttagctctacggtccagcagatattcgttggcgagcaggcgcaggcccaagcccaaacc
ggtgaatcggtatgcatcaccctggccgacgagcgcgacatcagccgcggtgatgtgctc
tgtgcggtcgatgctccactggagatggccgagcagttccatgcccatctgctgtggctg
cacgagcaagccctcatccccggtcgcccctattggctccaactgcaccaccgtaccgta
tcggccacggtgagctccatccgccaccgcatcgaccccaacagtggggcggaactagcc
gcgcgcgagctacagatgaacgatatcgccgaggtacacctgaacctcgatcgcccgctg
cccttcgccccctatgccgaaaaccgtcctcttggcgccttcatcctcatcgaccgcctg
agcaacgccaccgtgggcgccgggatgctggacttcgccctgcgccgcgatcacaacctg
cactggcagcaactcagcgtgaacaaagccgcccgcgccgcgctcaagcaccagccaccc
cggtgcgtgtggttcaccggcctgtccgggtcgggcaaatccaccctggccaatctgctg
gaaaagcgcctgcacgcccaagggcaccatacctacgtgctggacggcgacaatgtgcgc
cacggactgaaccgcgacctgggctttgccgaggccgaccgggccgagaacatccgccgt
gtggcggaggtggcccggctgatggtggatgccggtctgatcgtgctggtgtccttcatc
tcgccttaccgcgccgagcgggaattcgcccgcagcctcttcaccccaggggagttcctt
gaggtgttcgtggacacgcccctggaagaatgtgagcgacgcgatcctaagggaatctac
gcccgcgcccgggccgggcagattcccaactttaccggcatcagcagcccttacgagcta
ccgctgacaccagagctacgcctcagcacccccggcagcagtccggaagcgttgctggag
ccggtgttaatgtga

KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3124Help
Entry
AFE_3124          CDS       T00810                                 

Gene name
cysD-2
Definition
(GenBank) sulfate adenylyltransferase, small subunit
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00230  Purine metabolism
afr00261  Monobactam biosynthesis
afr00450  Selenocompound metabolism
afr00920  Sulfur metabolism
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01120  Microbial metabolism in diverse environments
afr01130  Biosynthesis of antibiotics
Module
afr_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AFE_3124 (cysD-2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AFE_3124 (cysD-2)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AFE_3124 (cysD-2)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    AFE_3124 (cysD-2)
Enzymes [BR:afr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     AFE_3124 (cysD-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: ACK80792
UniProt: B7JAM8
Position
2811574..2812512
Genome map
AA seq 312 aa AA seqDB search
MMHTTAEKHVLDAASNHHLDWLESEAIHIMREVAAECAKPALLFSGGKDSLVLLRIAEKA
FRPGKFPFPLVHIDTGHNFAEVIEFRDRRIAELGEQLIVRSVEESIRRGTVRLRNPASDS
RNAAQAVTLLEAIAEFQFDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWDL
YNTRIHPGENMRVFPISNWTELDVWQYIAREKLALPSIYFAHERQVIPRNGFLVPLTTLT
PAKEGEVIKTQVVRFRTVGDISCTCPVASDAATIEAIIAETAMTKITERGATRMDDRTSE
ASMEQRKKAGYF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatactacagccgaaaaacatgttctcgatgccgctagcaatcaccatctggac
tggctggaatcagaagcgatccacatcatgcgcgaggttgcggccgaatgcgccaaaccg
gcgctgctgttttccggcggcaaggattcgctggtgctgctgcgcatcgccgagaaggcc
ttccgccccggcaagttcccgtttccgctggtacatatcgatactggccacaatttcgct
gaggtcatcgaattccgcgaccgacgcattgctgaactgggcgagcaactgatcgtgcgt
tccgtcgaggagtcgatcaggcggggcaccgtgcgcctgcgtaatcccgcaagcgattcg
cgtaatgcggcgcaggccgtcacactgttggaggccattgccgaatttcagtttgatgcc
tgcatcggcggcgcccgtcgcgatgaagagaaggctcgcgccaaagagcggattttttca
ttccgcgatgagttcgggcagtgggatccgaaggcgcagcgcccagaactctgggattta
tataatacccgcattcatcctggcgaaaatatgcgcgtgttcccgatctccaactggacc
gaactagacgtttggcaatacatcgcccgcgaaaaactggcgctaccttcgatttatttt
gcccatgagcgccaggtcattccgcgtaacggctttctggtgccgctgaccacgctgaca
ccggccaaggaaggcgaggtaatcaagacccaggtcgtgcgtttccgtacggttggcgat
atctcatgcacctgcccggtggcatcggatgccgctaccatcgaggccatcatcgccgag
accgccatgaccaaaatcaccgaacgcggtgcaacccggatggatgaccggacatcggaa
gcatcgatggaacaacgcaagaaggcaggatatttctga

KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3125Help
Entry
AFE_3125          CDS       T00810                                 

Gene name
cysN
Definition
(GenBank) sulfate adenylyltransferase, large subunit
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00230  Purine metabolism
afr00261  Monobactam biosynthesis
afr00450  Selenocompound metabolism
afr00920  Sulfur metabolism
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01120  Microbial metabolism in diverse environments
afr01130  Biosynthesis of antibiotics
Module
afr_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AFE_3125 (cysN)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AFE_3125 (cysN)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AFE_3125 (cysN)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    AFE_3125 (cysN)
Enzymes [BR:afr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     AFE_3125 (cysN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D3 GTP_EFTU_D2 SRPRB Ras GTP_EFTU_D4
Motif
Other DBs
NCBI-ProteinID: ACK77827
UniProt: B7JAM9
Position
2812512..2813864
Genome map
AA seq 450 aa AA seqDB search
MSATIPKQFFQELTRERGLLRFITAGSVDDGKSTLIGRLLFDSKGIFADQLDAISHARHR
RTIGDAIDLSLLTDGLEAEREQGITIDVAYRYFATPRRKFIIADTPGHEQYTRNMVTGAS
TADAVVILIDVSKVKMGEDGSVELLVQTKRHSTIAHLLQIEHVVVAVNKMDLVHYDQAVY
DRIVQAYREFAQRLGLKDIRTIPLSALAGDNVVTAGDRMPWYQGPTLIELLESLSVYDAC
HDEPLRFPVQLVARHNGHEAKDFRGYMGRIEAGKVRRGDRLVVQPGGPAATVKDILILDQ
SLESAVVGQSVTLLLQEHLDISRGDMLASADRPASLLKTVTADVCWLSEDPLDLRRKYWL
KHTTRQVTARVIEINALLDINTQQKRPADALRLNDIASVTLNVQQPLAADAYDAIRATGA
FILIDEVTHQTVAAGMIRLDDSGVRNVSER
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgaccattcccaaacaattttttcaggaactgacgagagagcgcggcttgctg
cgcttcattactgccggttcggtggatgatggcaagagcacgctgatcggccgtctgctg
ttcgacagcaagggcatttttgccgaccagttggacgcgatatcccacgccaggcaccgt
cgcaccatcggcgacgcgatcgacttgtcgctgctgacggatggcctggaagccgagcgc
gagcagggcatcaccatcgacgtcgcttaccgctacttcgctacgccccggcgcaagttc
atcatcgccgataccccgggtcatgaacagtacacgcgcaacatggttaccggagcatcc
accgctgacgccgtcgtcatcctgatcgatgtctcgaaagtgaagatgggcgaggatggc
agcgtggaattactggtgcaaaccaagcgccattcgaccatcgcccacctgttgcagatc
gaacatgtcgtggtcgcggtcaacaagatggatctggtgcattacgaccaggcggtgtat
gaccgtatcgttcaggcgtaccgggaattcgcgcaacggctgggcctgaaggatatccgc
acgattccattgtccgccctggcgggcgacaatgtggtcactgcgggcgacaggatgccc
tggtatcaggggccaacactgatcgaactgctcgaatccctgagcgtctatgacgcatgc
catgacgaaccgctgcgttttccggtacaactggtggcgcgccacaacggccacgaagcc
aaggacttccgcggttatatgggccgcatcgaagccgggaaagtccgcaggggtgaccgg
ttggtggtgcaaccaggaggaccggcggcgaccgtgaaagacattctgatactcgatcaa
tcgctggaatcggccgtcgtcggccaatcggtaacgctgttgctgcaggaacacctggat
atttcgcgtggcgacatgctcgcgtccgccgatcgtccggccagcctgctcaaaaccgtc
accgccgacgtctgctggttgtcggaggatccgcttgatctgcgtcgcaagtactggctg
aaacacacgacccggcaagtcacggcgcgcgtcatagaaatcaatgcgttgctcgatatc
aacacgcaacagaagcgtccggccgatgccttgcggctgaatgacatcgccagcgtcacg
ctgaatgtgcagcagccgctcgccgctgatgcatatgacgccattcgcgcgaccggagcg
tttattttgatcgacgaagtgacacatcaaaccgttgcggccgggatgatccgtctcgac
gattccggggtgaggaatgtatccgaacgttaa

DBGET integrated database retrieval system