KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3011Help
Entry
AFE_3011          CDS       T00810                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase, putative
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00780  Biotin metabolism
afr01100  Metabolic pathways
Module
afr_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AFE_3011
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:afr01007]
    AFE_3011
Enzymes [BR:afr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     AFE_3011
Amino acid related enzymes [BR:afr01007]
 Aminotransferase (transaminase)
  Class II
   AFE_3011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP OKR_DC_1 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACK78743
UniProt: B7J9Y4
Position
2703590..2704915
Genome map
AA seq 441 aa AA seqDB search
MGQGARGLTAQIKDRLIQKTLERRLTQLEQTPVRTVVESGIPERFYRWDLHPGYQQVRLL
QEGAARFGVENPFFKVHEGTASAHSRIVEKTVVNYASYNYLGLSGHPLVNAAAKEAIDRY
GTSVSASRIVSGERPLHAQLERAIAQAYGVDDAIVMVSGHATNVTSIGYLFGPNDLVLHD
EYAHNSIIQGISLAGAKRLCFPHNDLEALEQILTQQRRQAERVLVVVEGIYSMDGDYPDL
PRFIEIKHRHRALLMVDEAHSFGVLGRHGMGIREHFDLDPKDVDIWMGTLSKALAACGGY
IAGASALVENLRYLAPGFLYSVGMAPPVAAAALSALQVLQAEPQRVSTLQQRSRYFLEKA
RGVGLQTGASTGNAIVPVITGSSLRAVRLSNWLLERGIHVQPILYPAVPERQARLRFFLS
SEHTLEDIDETMTILAEDLRA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggggcagggggccagggggttgacggcacagatcaaggatcggctgatccagaaaact
ttggagaggcgcctgacgcagttggagcaaacgccggtacgtactgtcgtggagagcggt
attccggaacggttttaccgctgggatctgcacccgggctaccagcaggtgcgcctgctg
caggaaggtgctgcgcgtttcggtgtagaaaacccgtttttcaaggtgcatgagggcacc
gcttcggcccacagccggatagtggaaaaaaccgtggtcaattacgccagttacaattac
ctgggtctgtctgggcatccgctggtcaacgccgcggctaaggaggccatcgaccgttat
ggaacttccgtgtccgcgagccgcattgtctctggagagcggcccttgcacgcgcagttg
gagcgggccattgcccaggcctatggcgtagacgacgccattgtgatggtgagcgggcat
gccaccaatgtcaccagcatcggttatctttttgggccgaacgatctcgttcttcatgat
gaatacgcccataacagcattatccagggcatcagcctggcgggtgccaagcgcctgtgc
tttccccataacgatctggaggccttggagcagatcctgacgcaacagcgtcgtcaggcg
gagcgcgtcctggtcgttgtcgagggtatctacagcatggatggggattaccccgacctg
ccccggtttatcgagatcaagcatcggcatcgggccttgctgatggtcgacgaggcccat
tccttcggcgtgttgggccgccacgggatggggatccgtgagcactttgacctggacccg
aaggacgtcgatatctggatgggcaccctcagcaaggcgctggcggcctgtggcggctat
attgcgggggcatcggccctcgtcgaaaacctgcgttatctggcccccggatttttgtat
agcgtcggtatggcgccacccgtggcggcggccgccttgtcggccttgcaggtgcttcag
gcggaaccacaaagggtgagcaccttgcagcagcgaagccggtattttttggagaaggca
cgcggcgttggcctgcaaacaggcgccagcaccggcaacgccattgtgccggtcataacc
ggcagttccctgcgcgcggtgcgcctttccaattggctgctggagcgagggattcatgtg
cagcccatcctgtatccagccgtcccggagcggcaggcacgcctgcgcttttttctgagt
tccgagcatacgctggaagatattgatgagacgatgacgattctggccgaagacttgcgt
gcctga

DBGET integrated database retrieval system