KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3059Help
Entry
AFE_3059          CDS       T00810                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00240  Pyrimidine metabolism
afr00250  Alanine, aspartate and glutamate metabolism
afr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AFE_3059 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFE_3059 (pyrB)
Enzymes [BR:afr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     AFE_3059 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACK80050
UniProt: B7JAG8
Position
complement(2748867..2749850)
Genome map
AA seq 327 aa AA seqDB search
MSATLRFGEGNLQYDAQGRLRHLLSTEGLRERELLQILDTAESFLSIANRSVKKTPTLRG
RTIANLFFENSTRTRSTFELAAKRLSADVLNIAVSTSSASKGESLTDTIDNLMAMQVDGF
VIRHPEAGAAHLVARHLGDSALVVNAGDGQHAHPTQALLDVFTIRRLGGPIEDRVVAIVG
DVFHSRVARSQIHALSVLGCPEIRVIGPRTLVPEELSALGVHVYHDLQAGLRGVDVICAL
RLQRERMESHRLPSLDEFHRRFGLTPERLQWAEPGALVLHPGPMNRGVEIASEVADGAQA
VILQQVAHGLAVRMAVLAILAGAAGGA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctaccctgcgttttggcgagggcaacctgcaatacgatgcgcagggccgcttg
cggcatctgctcagtaccgaagggctccgggagcgggaattgctgcagattctcgatacg
gcggaatccttcctcagtattgcgaaccgtagcgtcaaaaagacccccaccctgcgcggt
cgcaccatcgccaaccttttttttgagaacagcacccggacccgcagcacttttgagctg
gctgccaagcgcctctcggcggatgtgctgaatatcgcagtcagcaccagcagcgccagc
aagggcgagtccctcaccgatacgattgataatctcatggccatgcaggtggatggcttc
gtcatccgccacccggaggcgggcgcggcccatctagtggctcgtcatctcggtgattcg
gcgctggtggtgaatgccggtgacggtcagcatgcgcatccgacacaggctttgctggac
gtgttcacgatccgccgtctgggaggtccgatcgaggaccgggtggtggccattgtcggg
gatgtgttccattcgcgggtggcgcgttcgcagatacatgccctgtccgtcctcggctgc
ccggaaattcgcgtcatcggcccgcgcactctggtacccgaagaactttcggcgctgggg
gtgcatgtctaccatgatctgcaggccggtttgcgcggagtggatgtgatttgcgccctg
cgcctgcaacgggagcgcatggagtcgcaccggcttcccagtctggatgagtttcaccgc
cggttcgggctgacgccggagcgcttgcagtgggcggaacccggcgcgctggtgctgcat
ccgggccccatgaaccggggggtggaaattgcctcggaagtggccgacggggcccaggca
gtgattctccaacaggttgcccatggtctggcggtgcggatggcggtgctcgccatcctc
gccggcgcggcgggcggagcgtga

DBGET integrated database retrieval system