KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3063Help
Entry
AFE_3063          CDS       T00810                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00270  Cysteine and methionine metabolism
afr00480  Glutathione metabolism
afr01100  Metabolic pathways
Module
afr_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AFE_3063 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFE_3063 (gshB)
Enzymes [BR:afr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     AFE_3063 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: ACK78181
UniProt: B7JAH2
Position
complement(2751401..2752339)
Genome map
AA seq 312 aa AA seqDB search
MSALKAAILMDPITGIKPAKDTTFAMLLAAQARGHQCRVFGLPDLFFRDGRSWGRLRTII
VRDDVEDYFTLGETEERPLDEMDVVLMRKDPPVGLEYLTACYLLEHAGTWVVNDPVSLRN
ANEKLYALHFPEFLPPLLVSRDLGDLRAFLAEHGEIVVKPLSARGGEGVFYLHLQDRNVG
SILETVTGWGQHHVMAQRYLPAIREGDKRILLVDGVPVPGALLRVPSAADFRGNLVAGAT
GVAAEINDRDRDICAAIGPALRAAGLLFVGLDVIGGYVTEINVTSPTGAREIRRFFGVDA
ADLLWQRLERGR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgctcaaggccgctattcttatggatcccattaccgggatcaaaccggccaaa
gatacgacgttcgccatgctgctggcggcgcaggcgcgtgggcatcaatgccgggtgttt
ggcctgccggacctgttttttcgggatgggcgttcctggggacgactccgtaccatcatc
gtacgtgatgatgtggaagattattttacgctgggtgagacagaagagcgccccctcgac
gagatggatgtggtcctcatgcgtaaggaccctcctgtgggtctggaatatctcaccgcc
tgctatctgctggagcacgccggcacctgggtggtcaacgatccggtcagtctgcgcaat
gccaatgaaaagctctatgccctgcatttcccggaatttctgccgcccttgctggtcagc
cgggatctcggggatttgcgggcctttctcgccgaacacggcgaaatcgtcgtcaaaccg
ctctcggcgcgtggtggcgaaggggtgttctatctgcacctgcaggaccgcaatgtcggc
agtattctggagacggtgacgggctggggccagcatcatgtgatggcgcagcgctacctg
cccgcgattcgcgagggcgataaacggattctcctggtggatggtgtcccggtgccaggt
gccctgctgcgggtgccttcggccgcggattttcgcggtaatctggtggcaggtgcaacg
ggggtagcggcggagatcaatgaccgcgatcgggacatctgtgcggcgataggcccggcc
ttgcgcgctgcgggcctgctttttgtcggcctggacgtgatcggcgggtatgtgacggag
atcaatgtcaccagccccaccggggcgcgggagatcaggcgattttttggggtcgatgcg
gcggatctgctctggcagcgtctggagcgggggcgatga

DBGET integrated database retrieval system