KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3121Help
Entry
AFE_3121          CDS       T00810                                 

Gene name
cysJ
Definition
(GenBank) sulfite reductase (NADPH) flavoprotein, alpha component
  KO
K00380  sulfite reductase (NADPH) flavoprotein alpha-component [EC:1.8.1.2]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00920  Sulfur metabolism
afr01100  Metabolic pathways
afr01120  Microbial metabolism in diverse environments
Module
afr_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AFE_3121 (cysJ)
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  assimilatory sulfite reductase (NADPH)
     AFE_3121 (cysJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: ACK79817
UniProt: B7JAM5
Position
2807385..2809151
Genome map
AA seq 588 aa AA seqDB search
MELIRQSDFLLDPRKQEDLRRFAEGMTREQLLWSSGYLTGFGESAPASKIQEDIGEKITI
LFGTETGNAKRLAELLAARAQAMGVQTSIQDMLTYGRAQLRRDRVIVLIVSTHGDGEPPD
SARMLLASLTDGPVPDLHGSRFAILALGDASYPKFCQAGKAFDIALASAGAERLLPRVDC
DVDYERDAMYWMEQVLGALTTGKSSPAVPFPAPVPKQGYSSHATFPAVLLGKVNLSGRGS
DREVWHLELDLDGSGLHYAPGDIVSVAPSNPPQLVEELLDRLELDHKASVRTRQGEMPLV
EALAAHYEITRITWPFLERYARLSDAKALQSAIAGRDVNGLDTWTDGREVIDIVGQYPVK
GLSAQSFADCLRPLPPRRYSIASSLLAVPGEVHLTVAAIRYSSHGRERLGVASTFLADRV
AIGRPVPIFIEPNAEFRLPEDSGQAMIMIGAGTGVAPFRSFLQEREALGAAGNNWLFFGD
RHFSTDFLYQREWLRWLRDGRLTRLDVAFSRDQERKIYVQDRLRERAGDVFAWLEEGAAV
YVCGAEAMGRAVHQSLVDIVQSAGRTQVQAEEYILELKQTGRYHRDVY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggaattgatccgacaatcagactttctactggacccgcgaaagcaggaggacctgcga
cgtttcgcggagggcatgactcgcgaacaattgctgtggtccagcggctatttgacgggt
tttggggaaagtgcgcctgcctcaaaaatacaagaagacattggagaaaagatcaccata
ctgtttggcacggaaaccggtaatgccaagcggttggcggaacttttggcggccagggcc
caggcgatgggtgtgcaaaccagcattcaggacatgttgacgtatggtcgtgcacaattg
cgccgggatcgcgtcatcgtgcttattgtcagtacgcatggggatggtgagccaccagac
agtgcccgcatgcttttggcttcactgaccgatgggccggttccggatctgcacggcagc
cgctttgccatattggcattgggtgatgccagttatccaaagttttgccaggcgggaaaa
gcgttcgatattgccctcgcttccgccggcgccgagcgccttctcccccgagtcgattgt
gacgtcgattacgaaagggatgccatgtattggatggagcaggtcctgggggcactcacc
accggcaagtcctctccggcagtaccgtttccggctcccgttccgaaacagggatactcg
agccatgccactttccccgccgttctgctgggcaaggtgaatctctccggccgcgggtcg
gacagggaagtctggcatctcgaactggacctcgacggatctggccttcactatgcacca
ggcgatatcgtgtccgttgctccgagcaatccgccccaactcgtagaggagctactcgac
cggctcgaactggaccacaaggcctccgtacggaccagacagggtgaaatgccgctggtg
gaggccctcgccgcgcactatgaaatcaccagaatcacatggccctttctggagcgttac
gcgcgcctgagtgacgcgaaggctttgcaaagcgcgattgccgggcgagatgtcaacggc
ctcgacacttggacagacggccgggaagtcatcgacatcgtcgggcaataccccgtcaag
gggcttagtgcgcaatccttcgccgactgcctgcggcccttgccgccgcggcggtattcc
atcgcctccagccttctcgccgttccgggcgaggtccacctgacggtcgccgccatccgc
tacagcagccacggacgggagcgtctgggggttgcctcgacatttctggcggatcgtgtc
gccatcggccggcctgtacccatatttatcgaacccaatgccgaattccggctacccgaa
gattccggacaggcgatgatcatgatcggggccggaaccggggtggccccctttcgttcc
ttcctgcaggaacgggaggcgctgggtgctgccggaaataactggcttttcttcggggac
cgtcacttcagcaccgattttctataccagcgggagtggctgcgctggctcagggatggg
cgcctcacccgactcgacgttgccttctcccgcgaccaggaacgcaagatatacgtccag
gaccgtttgcgggagcgtgccggtgacgtattcgcatggcttgaagaaggtgccgccgtg
tatgtttgcggggccgaagcgatgggcagggcggtacatcaatccctggtggatatcgtt
cagtcggccgggcgcacgcaggttcaggccgaggaatatattctggaattgaaacagacg
gggagatatcaccgagatgtctattaa

KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3122Help
Entry
AFE_3122          CDS       T00810                                 

Gene name
cysI
Definition
(GenBank) sulfite reductase (NADPH) hemoprotein beta-component
  KO
K00381  sulfite reductase (NADPH) hemoprotein beta-component [EC:1.8.1.2]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00920  Sulfur metabolism
afr01100  Metabolic pathways
afr01120  Microbial metabolism in diverse environments
Module
afr_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AFE_3122 (cysI)
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  assimilatory sulfite reductase (NADPH)
     AFE_3122 (cysI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIR_SIR NIR_SIR_ferr Fer2_2
Motif
Other DBs
NCBI-ProteinID: ACK80342
UniProt: B7JAM6
Position
2809141..2810832
Genome map
AA seq 563 aa AA seqDB search
MSINDKALSDVERIKAESQGLRGTLRESLHNPVTGALAEDDVQVIKFHGIYQQDYRDLRA
ERHQQKLEPLYQFMARLRLPGGVLSGAQWLALGDIARTYGNASLRITSRQSIQFHGLLKP
HLRPVLQALDRALLDTVSACGDVNRNVIASSAPQISAFHAEAYGWAQKIAEHLLPQSHAY
HEIWLGGQQITAPEEDLLYGSTYLPRKFKIAIAVPPHNDVDVLTQDLGFIAIHEEGRLAG
FNVCVGGGLGRSHNKPDTYSRLADVCGFCAPGQVLAIAEAVLITQRDHGDRSNRSHARLK
YTVDRMGLDRFMEEVQQRTGFSLAPPRPFHFETSGDRFGWLENDDGTACLTLFIPGGRVA
DGDIPLLSGLDALARLHHGEIRLTCNQNLLIAGISPAERPVVETVLAEYGLNRLLNLAPV
RAHAMACVALPTCPLAMAEAERYLPVFLDRIEALLAEVGLEGEALTVRMTGCPNGCARPY
LAEIGLVGKAPGLYDLYLGGDRTGMRLNALYREALDEEALLDALRPLLKRFAGQRWAGET
FGDFVRRQDLLPPDPGLPHTGRR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtctattaatgacaaagcactttccgatgtggaacggatcaaggcagagagccagggg
ctgcgcggtacgttgcgggagagtctgcacaatcccgtcaccggtgcactggcggaagat
gacgttcaggtcatcaagttccacggcatttaccagcaggactatcgcgacctgcgggcg
gaacgccaccagcagaaactggagcccctgtatcaattcatggcccggctgcgcctgccg
ggcggcgtattgagcggagcgcaatggctggcgttgggcgacatcgcccgcacctacggc
aacgccagcctgcgtatcaccagcagacagagcatacaatttcacggactgctcaagccg
catctcaggccggtgctgcaagccctcgaccgggcactgctcgatacggtcagcgcctgc
ggcgacgtcaaccgcaacgtcatcgccagttccgcccctcagatctccgcctttcatgcc
gaggcatacggttgggcgcagaaaattgccgagcacctgctgccgcagagccacgcctat
catgaaatctggttgggcggccaacagataaccgcaccggaggaggatctcctgtacggg
tctacttatctgccccgcaagttcaagattgccatcgctgtgccgccgcacaacgacgtc
gacgtgctcacgcaggatcttgggttcatcgccatacacgaggaggggcgactggcggga
ttcaatgtttgcgttgggggaggccttggtcgcagccacaacaaacccgatacctactcg
aggctggcggatgtctgcggattttgcgcccccgggcaggtgttggccatagccgaagcc
gtgctcattacccagcgtgaccacggagaccgaagcaatcgaagccacgcccgcctcaaa
tacacggtagaccgtatgggtttggatcgcttcatggaagaggtgcagcaacgcaccgga
ttttcgctggccccgccgcgcccgtttcacttcgagacttcgggagaccggttcggctgg
ctcgaaaatgatgacggaacagcctgccttaccctcttcatacccggtggccgggttgcc
gatggtgatattccgctcctcagcgggctggatgcactcgcacgcctgcaccatggcgag
atccggctgacctgcaatcagaacctgctgatcgccggcatttcccccgcggaacgcccg
gttgtcgaaaccgtgcttgctgaatacgggcttaaccgattgctgaatctcgccccggtc
cgtgcccacgcgatggcatgtgtggcgctgcccacctgccccctggcgatggccgaggcc
gagcgctatttgccggtttttctggatcgcatcgaggcgttgcttgccgaggtcggtctg
gaaggagaagcgttgacggtgcgtatgaccggatgccccaacgggtgcgcccggccttat
ctcgcggagatcggcctggtcggcaaagcgccaggcctttacgatctttatctgggcggc
gatcggaccggcatgcgcctgaacgcactttaccgggaggcattggatgaagaagctctg
ctggatgccctgcgccccctgttgaagcgctttgccggccagcgctgggccggcgagaca
ttcggggactttgtgcggcgacaggatttattaccgccggatcccggccttccgcataca
gggagacggtga

DBGET integrated database retrieval system