KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3242Help
Entry
AFE_3242          CDS       T00810                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01130  Biosynthesis of antibiotics
afr01230  Biosynthesis of amino acids
Module
afr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AFE_3242 (trpC)
Enzymes [BR:afr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AFE_3242 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACK80131
UniProt: B7JBC0
Position
complement(2918441..2919232)
Genome map
AA seq 263 aa AA seqDB search
MTDILQEIIAHKREELVERQTRLGLAELQAAVALTAPPRNFVGAVRARMAQGQPAVIAEI
KKASPSAGVIREDFNPVTIAQDYAAHGAACLSVLTDEHYFQGADLYLAAAREACPLPVLR
KDFCIDPYQVWEARAIGADAILLIVAALSDAELQSLEATAQSLDLAVLVEVHDAAELQRA
LKLRTPLIGINNRDLRRFVTEIETTLKLLPEIPRERIVVTESGIRSREEVATLRAAGVGA
FLVGEAFMRTAQPGDALQHLFFD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatacttcaggaaatcattgcccataagcgggaggagctggtggagcgccaa
acccgtctgggccttgcggagctgcaggcggcagtggccctgacggcaccgccgcgcaac
ttcgtcggcgccgttcgcgccagaatggcccagggacagcccgcagtgatcgccgaaatc
aaaaaggcatcgccgtcggcgggggtaatccgcgaagacttcaatccggtgaccattgcc
caagactacgccgcccatggcgcagcctgcctgtcggttctgaccgatgaacactatttt
cagggcgccgacctctatctcgccgccgcccgtgaggcctgcccactgcccgtgctacgc
aaggatttctgcatcgatccctatcaggtctgggaagcacgggccattggggccgacgcc
atcctgctcatcgttgcggccctgagcgatgccgagctgcagagtctggaggcaacggcg
cagagcctggatctggcggtgctggtggaggtgcatgatgcagccgagttacagcgcgca
ctaaaattgcgtaccccactgatcggcatcaataaccgggatctgcggcgttttgtcacc
gaaattgaaaccacgctgaaactgctccccgagattccccgagagcggatcgtcgtcacc
gaaagcggcatccgcagccgggaggaggtggccaccctgcgcgccgcgggagtcggtgcc
tttctcgtgggcgaggcatttatgcgcaccgcccagccgggagacgccctgcaacacctg
ttttttgactaa

DBGET integrated database retrieval system