KEGG   Actinoplanes friuliensis: AFR_11550Help
Entry
AFR_11550         CDS       T02892                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00220  Arginine biosynthesis
afs00250  Alanine, aspartate and glutamate metabolism
afs00290  Valine, leucine and isoleucine biosynthesis
afs01100  Metabolic pathways
afs01110  Biosynthesis of secondary metabolites
afs01130  Biosynthesis of antibiotics
afs01210  2-Oxocarboxylic acid metabolism
afs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFR_11550
   00290 Valine, leucine and isoleucine biosynthesis
    AFR_11550
   00220 Arginine biosynthesis
    AFR_11550
Enzymes [BR:afs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AFR_11550
    2.6.1.66  valine---pyruvate transaminase
     AFR_11550
Amino acid related enzymes [BR:afs01007]
 Aminotransferase (transaminase)
  Class I
   AFR_11550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGZ40599
UniProt: U5VUS9
Position
complement(2497003..2498217)
Genome map
AA seq 404 aa AA seqDB search
MLGMEQASRLKNVRYDIRGPVLRRAQELEAAGNRILKLNLGNPAPWGLSTPEPIVADMVQ
HLSDAEGYSDARGIYSARVAVAQYYQTLGVESVQPDDVFLGNGVSELIVMSLQALLNTGD
EVLVPSPDYPLWTGAVTLCGGKPVHYRCDENEDWAPDLEHVAAQVTPNTRAIVIINPNNP
TGAVYSRETLLGLLEIARRHDLLVLADEIYDKILYDDARHECAAALAPDLLVLTMSGLSK
AYRAAGFRSGWMAVSGPTTHATEYLEGLQLLANMRLCPNVPAQHAVQTALGGFQSITTLI
RPGGRLYEQRNHAWRKFNEIPGVSCVKPRGALYLFARLDPEVHKIRDDQKMIIDLLEQQL
MLLSHGSGFNLPTPDHLRMVFLAPVDVLDDATDRLRRFLENYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggtatggagcaggcgagcaggctcaagaacgtccggtacgacatccgcggtccc
gtgctgcgccgtgcccaggagctggaggccgccgggaaccggatcctcaagctcaacctg
ggcaatcccgcgccgtggggcctgagcacgccggagccgatcgtcgccgacatggtgcag
cacctgagcgacgccgagggttacagcgatgcgcggggcatctactccgcgcgggtcgcc
gtcgcgcagtattaccagactctcggtgtcgaaagcgtgcagcccgacgacgtcttcctc
ggcaacggggtctccgagctgatcgtgatgtcgttgcaggcgctgctcaacaccggcgac
gaggtgctggtgcccagccccgactatccgctctggaccggggccgtgacgctgtgcggg
ggcaagcccgtgcactaccgctgcgacgagaacgaggactgggcaccggatctggagcac
gtcgccgcgcaggtcaccccgaacacccgcgccatcgtgatcatcaatccgaacaacccg
accggtgccgtctattcgcgggagacgctgctcggcctgctcgagatcgcccggcgccac
gacctgctcgtgctggccgacgagatctacgacaagatcctgtacgacgacgcgcgccac
gagtgcgcggcggctctggcccccgacctgctcgtgctgacgatgagcggtctgtccaag
gcctaccgcgcggcgggtttccgctccggctggatggcggtcagcggcccgacgacccac
gccaccgagtacctcgagggtctgcaactgctcgcgaacatgcggctgtgcccgaacgtg
ccggcccagcacgcggtgcagaccgcactgggtggcttccagagcatcaccacgctgatc
cgccccggcgggcgcctgtacgagcagcgcaaccacgcctggcgcaagttcaacgagatc
cccggggtcagctgcgtcaagccccgcggggcgctctacctcttcgcgcggctcgacccg
gaagtccacaagatccgcgacgaccagaagatgatcattgatctgctggagcagcagctg
atgctgctctcgcacggttcgggcttcaacctgcccacgcccgaccacctgcggatggtg
ttcctggccccggtcgacgtgctcgacgacgccaccgaccggctgcgccgattcctggag
aactaccggcaatag

DBGET integrated database retrieval system