KEGG   Actinoplanes friuliensis: AFR_19085Help
Entry
AFR_19085         CDS       T02892                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00030  Pentose phosphate pathway
afs00480  Glutathione metabolism
afs01100  Metabolic pathways
afs01110  Biosynthesis of secondary metabolites
afs01120  Microbial metabolism in diverse environments
afs01130  Biosynthesis of antibiotics
afs01200  Carbon metabolism
Module
afs_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
afs_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:afs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AFR_19085
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFR_19085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afs04147]
    AFR_19085
Enzymes [BR:afs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AFR_19085
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AFR_19085
Exosome [BR:afs04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AFR_19085
  Exosomal proteins of colorectal cancer cells
   AFR_19085
  Exosomal proteins of bladder cancer cells
   AFR_19085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AGZ42089
UniProt: U5VZ11
Position
complement(4177314..4178708)
Genome map
AA seq 464 aa AA seqDB search
MATKKTVFVLFGATGDLARRMVLPAFYTLAIEGLLPEDWVLVGNGRGDVAHEDFRKHVHD
VLVEFGPHPDRGPWKEFEQRLYFAGGGFDTDSPGSLLDVIGEARRRVGARAQLVHYLAVP
PVTFPELTKALGQHGLAKGARVVYEKPFGTSPKGFRSLNRIVHSVLDESQVYRIDHFLGK
EATQNLHVLRFANELFAAMWNRDHIESVQIDVPEDLGVDDRAGFYDATGAVLDMLVTHLF
QVAAEVAMEPPETLTAPDLQSARERVIRAFRPLDPAEVVLGQFDGYRKVKGIEPRSTTDT
YVAAKLWIDNPRWQGVPFLLRTGKRMAVSEQRVTVVLRTPQGPLKGLPGQANALSFSLAG
NGEIALSLLAKKPGIELHLESATVKLPLAELPDAEPLPPYVRLIHDVLLGDRSLFTRPDG
LSAAWRTVQPILDNPPRLHKYAQDSMGPAAAKKLAAPHGWLLGQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaagaagactgtgttcgtgctgttcggtgccaccggcgacctggcccggcgg
atggtgctgcccgcgttctacaccctggcgatcgagggcctgctgcccgaggactgggtc
ctggtcggcaacggccgcggcgacgtcgctcacgaggacttccgcaaacacgtccacgac
gtgctcgtcgagttcggaccgcaccccgaccgggggccgtggaaggagttcgagcagcgg
ctctacttcgcgggtggcggcttcgacaccgactcccccggcagcctgctcgacgtcatc
ggtgaggcccgccgccgcgtcggcgcacgcgcccagctcgtccactacctggccgtgccg
cccgtcacgttcccggagctgaccaaggcgctgggacagcacggcctggccaagggggcc
cgggtcgtctacgagaagccgttcggcacgtcaccgaagggcttccgctcgctgaaccgc
atcgtgcactcggtgctggacgagtcgcaggtctaccggatcgaccatttcctgggcaag
gaggcgacgcagaacctccacgtgctgcgcttcgccaacgagctgttcgcggccatgtgg
aaccgcgaccacatcgagagtgtgcagatcgacgtccccgaggacctcggcgtcgacgac
cgcgcgggcttctacgacgcgaccggtgccgtcctggacatgctggtcacgcacctgttc
caggtcgccgccgaggtcgccatggagccaccggagaccctgacggcaccggacctccag
tcggcgcgcgagcgggtgatccgcgcgttccggccgctggacccggccgaggtggtgctg
ggccagttcgacggctaccgcaaggtcaagggcatcgagccccggtccaccacggacacg
tacgtcgccgcgaagctgtggatcgacaacccgcggtggcagggtgtgccgttcctcctg
cgtaccgggaagaggatggcggtgagcgagcagagggtgaccgtcgtcctgcgcacgccg
cagggcccgctcaagggcctgccgggtcaggcgaacgccctgtcgttctccctcgcaggc
aacggtgagatcgccctgagcctgctggcgaagaagcccggcatcgagctgcacctcgag
tcggccacggtgaagcttccgctggccgagctgcccgacgccgagccgctgccgccttac
gtgcggctgattcacgacgtgctgctcggcgaccgatcgctcttcacccgcccggacggc
ctgtcggcggcctggcgcacggtccagccgatcctggacaacccgccccgcctgcacaag
tacgcgcaggactcgatgggcccggccgccgcgaagaagctggcggccccgcacggctgg
ctgctcggccagtag

DBGET integrated database retrieval system