KEGG   Actinoplanes friuliensis: AFR_20775Help
Entry
AFR_20775         CDS       T02892                                 

Definition
(GenBank) phenylacetate-CoA ligase
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00360  Phenylalanine metabolism
afs01100  Metabolic pathways
afs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AFR_20775
Enzymes [BR:afs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     AFR_20775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding LuxE GH3
Motif
Other DBs
NCBI-ProteinID: AGZ42427
UniProt: U5W071
Position
complement(4528524..4529831)
Genome map
AA seq 435 aa AA seqDB search
MQDRTPRPEDLDPIERASVDELRALQLERLQWSLRHAYENVPQYRKMFDEIQAHPDDLHQ
LGDLAKFPFTDKAVLRANYPFDMFAVPRERISRLHASSGTTGRPTVVGYTKDDVRTWARL
MARSIRASGGRPGDRVHVAYGYGLFTGGLGAHYGAEELGCTVIPVSGGMTERQVMLINDF
KPDIIMVTPSYMLAIVDEMHRQGVDPRSTSLAVGIFGAEPWTQDLRTEIEQQLDIHALDI
YGLSEVMGPGVATECVETKDGLHVWEDHFYPEIIDPVTGEVLPDGETGELVLTSLTKQAM
PVVRYRTRDLTRLLPGTARPMRRIEKITGRTDDMIILRGVNLFPTQIEELILRTPELAPH
FQCLLTRDGRLDAMTVKVERRHGIGAPAAEAAGRQLATLVKNTIGVSVAIDVIEPDGVER
SMGKMRRIVDQRPKD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaccgcaccccccgacccgaagatctcgacccgatcgagcgggcgtccgtcgac
gagctgcgcgcgctgcagctcgagcgcttgcaatggtcgctgcggcacgcctacgagaac
gtcccgcagtaccggaagatgttcgacgagatccaggcccacccggacgacctgcaccag
ctcggtgacctggcgaagttcccgttcaccgacaaggccgtgctgcgggcgaactacccc
ttcgacatgttcgccgtgccccgcgaacggatctcccggctgcacgcctcgtcggggacg
acgggacgcccgaccgtcgtcgggtacacgaaggacgatgtccggacctgggcccggctg
atggcccgctcgatccgggcctccgggggccgccccggcgaccgggtgcatgtggcctat
ggatatggcctgttcaccggcggtctcggcgcgcactacggcgcggaggagctcggttgc
acggtcatcccggtgtcgggcggcatgaccgagcggcaggtcatgctgatcaacgatttc
aagccggacatcatcatggtcacaccgagctacatgctggcgatcgtcgacgagatgcac
cgccagggtgtcgacccgcgcagcacctccctcgccgtgggcatcttcggcgccgagccg
tggacccaggacctgcgcaccgagatcgagcagcagctcgacatccacgcgctcgacatc
tacggcctgtccgaggtgatgggacccggcgtcgcgaccgagtgcgtggagaccaaggac
ggcctgcacgtctgggaggaccacttctacccggagatcatcgacccggtgaccggcgag
gtgcttcccgacggcgagacgggcgagctcgtcctcacgtcgctgaccaagcaggcgatg
ccggtcgtgcgctaccggacccgggacctcacgcgcctgctgccgggcacggcccgcccg
atgcgccgcatcgagaagatcaccggacgcaccgacgacatgatcatcctgcgcggcgtc
aatctcttccccacccagatcgaagagctcattctccgtacgcccgaactggccccgcac
ttccaatgcctgctgacccgcgacggccgtctcgacgccatgaccgtcaaagtggaacgc
cgccacggcatcggggcgccggcggccgaggcagcggggcggcagctcgccaccctggtg
aagaacacgatcggcgtcagcgtggcgatcgacgtgatcgagcccgacggggtcgaacgc
tcgatgggcaagatgcgccgcatcgtcgaccagcgcccgaaggactaa

DBGET integrated database retrieval system