KEGG   Actinoplanes friuliensis: AFR_22960Help
Entry
AFR_22960         CDS       T02892                                 

Definition
(GenBank) fibronectin type III domain-containing protein
  KO
K12567  titin [EC:2.7.11.1]
Organism
afs  Actinoplanes friuliensis
Brite
KEGG Orthology (KO) [BR:afs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:afs01001]
    AFR_22960
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:afs04131]
    AFR_22960
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:afs04812]
    AFR_22960
   04147 Exosome [BR:afs04147]
    AFR_22960
Enzymes [BR:afs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AFR_22960
Protein kinases [BR:afs01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   AFR_22960
Membrane trafficking [BR:afs04131]
 Others
  Actin-binding proteins
   Others
    AFR_22960
Cytoskeleton proteins [BR:afs04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     AFR_22960
Exosome [BR:afs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFR_22960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N Mo-co_dimer DUF4959 SGL NHL
Motif
Other DBs
NCBI-ProteinID: AGZ42862
UniProt: U5W1G4
Position
4961211..4973363
Genome map
AA seq 4050 aa AA seqDB search
MATALPRRVQEWAMAVRRVSGPRRSVAMAAVVALAVLSSVIGLASPAAAAGGFVLSIYGG
TGAAAAPVAGPVSASPIGRPDAMTSDAAGNVYVYVRSACRVVKISPAGVLSPVAGSGTCG
TGSAGDALQSALSTNVTSLAVDGSGNLFVGDSGSARIYKVTPGGTLSVFAGNGTVGATTN
GSATLSSVVPDSLAVDSTGTVFVGYVGRASVLKITAAGALTRYAGTGNAGLTLPGISTLA
NLNKPSSLAVDTSGNLYIGDTGNNRIYLVTTGQILSAFAGNGTTGSPVPGSTSSPVPTPA
AMTFDSASTLYVAESSSRQILSFTLSGNGAPSLVAGSGGTGTPNPGTATSSPLGTVTALT
ATAPSSLVVGDSTYNYLLRIAAPTAPDAPTGLSAVPGPSRAVLTFSPPAGNGGSAITGYE
VSTNNGTSWAALTVTGSTTRTGTVTGLTNGTAYTVRVRALNAIGNGAASAATTVTPATAP
DAPYGLVVLAGDAAAALSFSPPLSNGGSAITGYEVSTDTGSSWTPIATTAGLLGVRNGSV
TGLTNGISYTFQVRAANVVGAGPATAGVSATPRGAPYAPTALTATTGNAQATLTFTTPPD
GGNTILGYQVSTDDGATWSGLVVSTSGTTNTATLTNLSNGTVYPVRVRALNLAGAGVPSA
ATTVSLAALVPDAPTGLVATAGDTTIGLSFAPPASTGGSALTGYEASTDNGTTWVPITTA
AGLLGVRTATLTGLTNGTAYAVRVRAVNAVGPSPAGGSAAATPRGAPYAPTGLTAVAGDR
QIGVTFTTPGDGGSAILGYQVSTDNGATWSGLAVTTSGTTNTATVTGLTNGVAYTVKVRA
ASLLGTGAASPGVPVVLQALVPGAPTGLVALAGDTTIALSFAPPATDGGSAITGYEASTD
NGTTWAPITTAAGLLGTRTATLTGLTNGTTYAVRVRAVNAVGPGPAGTSVNATPKGAPYA
PTGLSAVAGNTQATVTFTTPRDGGNPILGYQVSTDDGTTWSNLAVTTSGTTNTGAVGGLT
NGTTYAIRVRAVSLGGTGAASAGTAVVLPALVPAAPTALFATAGDTTISVSFAPPATNGG
AVITGYEASTDNGTTWAPITTAAGLLGNRTATLTGLTNGVTYTVRVRATNAAGASATSDS
TTATPRGTPYAPAGLSAVPGNGQAVLTFTTPGDGGYPILGYQVSTDDGATWTTLTVATSG
TDNTGTVTGLANGTTYAIRVRARNLAGAGTPSAATAVIPATVPGAPTAVAAAAGNTQITV
TFTPPAATGGRPITGYEVSTDNGTTWAALPDSGLVTGLTNGVAYAVRVRAVNAVGAGTAS
ASTTVTPIPATPDPPTGLAAERGDRSALLTFTPPVMTGTSPISGYEVSTDDGTSWAALAS
DRRVTGLTNGTAYTIRVRAVNASGAGPAGAAVTVTPATLPGAPTGLTVTIGDTRAVLAFT
APGDTGGDPITGYEVSTDDGTTWAPLAANRTVTGLTNGASYTFRVRAVNSVGPGPATAGS
TATPATTPGAPTGVTATPGDNRAVVTFTPPASDGGSPITGYEVSTDDGVSWDTLAADGTV
TGLSNNTTYTIRVRALNAAGPGPAGAATSVTPVDGLPGAPTALVAARGDRSTTLTFTAPA
DPGSSAISGYEVSTDNGASWAALAPDRRVTGLANGTTYTVQVRAVNDAGAGPASGGATVT
PAAAPGAPAEVRASRGNRSATLTFTAPVNDGGDPITGYQVSTDNGATWVTLAGDRTVTGL
TNGTTYAIRVRAVNGVGPGTPSAPVTVTPATSSGAPTALVAVRGNGSAALSFTAPDDTGG
DPVTGYQVSTDNGVTWASLAGDRVVTGLTNGVTYTIRVRAVNSSGPGAASAPALVTPATA
PGMPTGLSATAGDGTATLMFRAPDDGGDQITGYEVSVDDGTTWAALAGDHIVTGLTNATT
YTVRIRALNSAGTGPPSASATVTPIAGVPGAPTGLTAVRGDSSVTLTWTAPADPGSSAIT
GYDVSTDAGVTWTALAGDGIVTGLTNGTAYDFWVRARNAVGPGPASDSVTATPATTPQAP
TALTANPGDTTVTLAFRAPVDDGGAVIIGYDVSTDDGGTWAALPGDRTITGLTNGNAYTI
RVRAVNDVGAGPAGDPVTATPSQGRPGVVTGLSATAGNTTATLSFTAPADPGSSAITGYD
VTIDGGVTWTPLAGNRVVTGLTNGTAYFIAVRARNSTGAGPAGAEVMVIPVTTSAAPTGL
TADAGDSVATLTFTAPADTGGDPVTGYEVSTDNGTTWSPLTVSGTTTLTGTVTGLTNGTP
YPVRVRALTAAGPGAPSDSVTVTPATAADAPASFAVTAGDSSLQLMFSPPASDGGNPVTG
YEVSVDDGTTWAAVAGDRIVTGLTNGVTYQVRVRAVTAAGPGAATDAVTITPVGGLPGAP
TGLSVTRGDRSATATFTPPADPGSSAITGYEVSTDDGWNWAPLAPSGVIPALTNGTTYVV
RVRAVNTTGAGPAGDGVPVTPAAVPGPPTGLRVTAGDTTATVAFTAPADDGGAAITGYEV
STDNGVTWAALANDRRIPGLTNGTTYSVRVRAVNDVGAGPAGAAVTVTPRALPGAPTDVT
ATPGNASATIAFTPPADGGATITGYEVSTDNGATWRSLAANGTVPDLTNGTTYTVRIRAR
NSAGAGPASAAVTVTPAAVPGAPTDLTAVPGDGTATLSFTAPAAGGSAITGYDVSTDDGV
TWAPLAGGVVTGLTNGDTYTVRVRARNSVGAGPASNPVTVTPATVPDAPAGLTATPGNAS
ISVTFSPPADGGSPITGYEASSNNGTTWSPLTVSGATTRTGTLTGLDNGTTYAVRVRARN
SAGAGPASANATATPTAGLPGTPGGVSVARGNASATVTFTPGGGTVTGYQVSTDDGETWR
TLPADGTITGLTNGVTYAVRIRAVNNSGTSAASPSVTVTPATTPGAPTQVTAVRGDRSAT
LTFTPPAGDGGAPITGYETSVDGGDTWTVLGDDGVVGGLSNGTAYTIRVRARNDVGAGPA
AVAPPVTPAAGPGAPTGVSAVPGDGRVTVTFTPPASDGGSTITGYEVSVDNGTTWAALAG
TGIVTGLTNGTAYTIRVRALSGAGTGPASAAVTVTPATVPASPTGLSAAPGDASATVTFS
PPNAGGSPITRYEISTDDGASWATLAVAGTGATRTGMVDGLTNGAEVQVRVRARNDVGPG
APSAAVAVTPVTGLPSAPGDVTVTPGNASVSIAFTPPTGGVTSYEVSIDDGVTWTTLAGN
GIVAGLTNGTAYTVRIRARNATGAGPASPGYVTTPATTPAAPTALSATRGPGSATLTFTP
GATGGTPVTSYETSIDGGATWQTLQAGGIVTGLTNGTAYTIAVRARNAVGAGAIATVTVT
PATTPGAPTAVTAARGDASASVAFTAPASTGGAAILRYEVSVDNGTTWATLAGNRIVTGL
TNGTAYAIRLRAVNEVGAGAPSATASVTPATTPGAPTAVAVSPGDASASVNFTAPASTGG
AAITGYQVSTDNGTTWAALAGNRIVTGLTNGTAYLIRVRAVNEVGTGAPSAATTVTPAVA
LPGAPTGLTVTRGDGSATVAFTAGGGDPVSYEVSADGGVTWTALAADRVVTGLTNGTTYA
IAVRAVNPAGAGPATPAVTVTPATLPGAPTLGSVVFTTTSVTITFTAPATDGGSPVTAYE
LSLDGGATFNPVTPTGTGTLTVTVTGLTSGTVYAVALRARNAVGAGPADSEFAASTPPAA
PTQLAVTRGDASATLTFTPPDDETITGYQVSTDNGATWTDLAVEGTSPLTATVTGLDNTS
TYRFRVRAVNEAGPGRASDAVTSTVATAPGAPQAVTATGRTSSILVTWAPPDNSPVPVTG
YRAVASPGPATCTTGPSETSCVLGGRAGVEYTVRVVALSTGGSTTSTASATATPVAPSLP
TAPPSSAPSLTTADGDITTAVPGQEIVLVGDGFAPHSTVQIAVYSKPQLLDTVVTDADGS
FRKLVRLPAGLAAGQHTLLATGVDPDGNVLVRTLSVTVKAATSAPTAPSVDPEPGTSMPK
TGQNIALVAALGLLMICVGTGLVLVRRDRR
NT seq 12153 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaccgcgctgccgcggcgggtgcaggagtgggcgatggcggttcggcgggtttcc
ggtccgcggcgttcggtggcgatggctgcggtcgtcgcgctggccgtcctctcctcggtg
atcggtctggcgtcacccgcggctgcggccggcgggttcgtgctgtcgatctacggcggg
acgggtgctgccgcggccccggtggccggtccggtgtccgccagcccgatcgggcgtccg
gacgcgatgacctcggacgccgcgggcaacgtctacgtctacgtgcgctccgcctgccgg
gtcgtgaagatctcgccggcgggtgtgctgtccccggtcgccggcagtggcacctgtggg
accggcagcgccggtgacgcactccagtcggccctgtccacgaacgtcacctcgctcgcg
gtggacggctccgggaatctgttcgtcggcgacagcggctcggcgcggatctacaaggtc
actcccggcgggacgttgtccgtttttgccggcaacgggaccgtgggggcgacgaccaac
ggatcggcgacgttgtcctcggtcgttccggacagcctggccgtggacagcaccggcacc
gtgttcgtcgggtacgtcggccgcgcctccgtcctgaagatcaccgcggcgggggcgctg
acgcggtatgcgggcaccgggaacgcgggtctgacgctgccgggcatctccacgctggcc
aacctcaacaagcccagcagcctggccgtcgacacctccggcaacctctacatcggcgac
accggcaacaaccggatctacctggtcaccacggggcagatcctcagcgccttcgccggc
aacgggacgacggggagcccggtgccggggagcaccagttcacccgtaccgactccggcc
gcgatgaccttcgacagcgcttcgactctctacgtcgccgagagttccagtcgtcagatc
ctgtcgttcaccctgagcggtaacggcgcgccgtcgctggtcgccgggagcggcggcacg
ggtacgccgaacccgggcaccgccaccagttcgccgttgggcacggtcaccgccctgacc
gcgaccgcaccgagttccctggtggtcggtgacagcacctacaactatctgctccggatc
gcggcgccgaccgcacccgacgcgcctaccgggctgtcggccgtaccgggtccgtcacgg
gcggtcctgacgttctcgccgccggcgggcaacggtggcagcgccatcaccggctacgag
gtgtccaccaacaacgggaccagctgggcagcgctgaccgtcaccgggagcaccaccagg
accggcacggtgaccggtctgaccaacggaaccgcttacaccgtacgggttcgcgcgctc
aacgccatcggcaacggcgcggccagcgcggcgaccaccgtcacgccggcaaccgcgccc
gacgcgccgtacgggctggtggtcctcgccggtgacgccgcggcggcgctgtccttcagc
ccgccgttgagcaacggcggcagcgcgatcaccggctacgaggtgtcgaccgacacaggg
agcagctggacgccgatcgccaccaccgcgggtttgctgggtgtccgcaacggctcggtc
accggcttgaccaacggcatctcgtacacgttccaggtgcgggcggccaacgtcgtcggc
gcgggtccggccaccgccggggtcagcgccacgccgcggggtgcgccctacgccccgacc
gcgctgacggcgaccaccggcaacgcccaggcgacgctcaccttcaccaccccgcccgac
ggcggcaacacgatcctcggctaccaggtgtccaccgacgacggcgccacctggtcgggc
ctggtggtgagcacctccggcacgaccaacaccgcgaccctcaccaatctgagcaacggc
acggtctatcccgtacgcgtcagggccctgaacctggcgggcgcgggcgtgccgagcgcg
gccacgacggtttccctggccgcgctggtgccggacgcacccaccgggctcgtcgcgacc
gccggggacacgacgatcgggctcagcttcgcgccgccggcgagcaccgggggcagcgcc
ctcaccgggtacgaggcgtcgaccgacaacggcacgacgtgggtgccgatcaccaccgcc
gcggggctgctgggtgtgcggaccgcgacgctcaccgggctgaccaacggcaccgcttac
gccgtacgcgtccgggccgtcaatgcagtcggaccgagcccggccggcggcagcgcggcc
gccacgccccggggcgcgccctacgcacccaccgggctcaccgcggtggccggtgaccgg
cagatcggcgtgaccttcacgaccccgggtgacggcggctcggcgatcctgggctaccag
gtgtcgaccgacaacggcgccacctggtcggggctggcggtgaccacctcgggcaccacc
aacaccgccaccgtcaccgggctcaccaacggtgtcgcctacaccgtcaaggtccgggcg
gcgagccttctcggcaccggagcggccagccccggagtgcctgtcgttctgcaggcgctg
gtgccgggggcgccgaccggactggtcgcgctggccggtgacacgacgatcgcgctcagc
ttcgcaccaccggccaccgacggcgggtcggcgatcaccggctacgaagcctcgaccgac
aacggcaccacgtgggcgccgatcacgaccgccgcgggactgctgggcacgcgcaccgcg
acgctcaccgggctgaccaacggcacgacgtacgcggtccgggtccgtgccgtgaacgcg
gtcggccccggccccgccggcacgagtgtcaacgcgaccccgaagggcgcaccgtacgca
cccaccgggctgtccgcggtggccggcaacacccaggcgaccgtcaccttcaccaccccg
cgcgacggcggcaacccgatcctcgggtaccaggtgtccaccgacgacggcacgacctgg
tcgaacctggcggtcaccacgtccgggaccaccaacaccggcgcggtcggcgggctgacc
aacggcaccacgtacgcgatccgcgtccgcgcggtgagcctcggcgggacgggcgcggcg
agcgcgggcaccgccgtggtgttgccggcgctggtgcccgcggcgcccacggcactgttc
gcgaccgccggcgacaccacgatctcggtcagcttcgcgccgcccgcgaccaacggcggc
gcggtgatcaccgggtacgaggcctcgaccgacaacggcacgacctgggcgccgatcacc
acggctgccgggctgctcggcaaccgcaccgcaacgctgaccgggctgacgaacggcgtc
acgtacaccgtccgggtccgcgccaccaacgccgccggggcgagcgccaccagcgacagc
accaccgccactcctcggggtacgccgtacgcaccggccgggctctccgcggtgccgggc
aacggccaggccgtcctgacgttcacgacaccgggcgacggcgggtacccgatcctcggc
tatcaggtgtccaccgacgacggcgcgacctggaccacgctcaccgtcgcgacctcgggc
accgacaacaccggcacggtcaccgggctggccaacggcaccacgtacgcgatccgcgtc
cgcgcccgcaacctcgccggggcgggcacacccagcgccgccaccgcggtgatccccgcg
accgtccccggagcaccgaccgctgtcgccgccgccgcgggcaacacgcagatcacggtg
acgttcactcccccggcggccaccggcgggcggccgatcaccgggtacgaggtgtccacc
gacaacggcacgacctgggccgccctgcccgacagcggactcgtgaccgggctgaccaac
ggcgtcgcgtacgccgtccgggtccgcgcggtcaacgccgtcggcgcgggcaccgcgagc
gcgagcaccacggtcaccccgatccccgcgacacccgatccgccgaccggtctcgccgcc
gagcgcggtgaccgcagcgcgttgctgaccttcacaccaccggtgatgaccggtaccagc
ccgatcagcgggtacgaggtctccaccgacgacggcacgagctgggcggcgctggcctcc
gatcgccgggtcaccggactgaccaacggcacggcgtacacgatccgggtccgggcggtg
aacgcttccggtgccggaccggcgggcgcggccgtcaccgtcacgccggccacgcttccc
ggggcaccgaccggtctgaccgtgacgatcggtgacacccgggccgtgctggccttcacc
gcgccgggcgacaccggcggtgacccgatcactggatacgaggtgtccaccgacgacggc
acgacgtgggcgccgctcgccgcgaaccgcaccgtgaccggcctgaccaacggcgcctcc
tacactttccgggtccgcgcggtgaacagcgtcggccccggcccggccaccgcgggcagc
acggccacaccggcgaccacacccggtgccccgaccggggtgacggccacgcccggcgac
aaccgcgcggtcgtcacgttcacaccgcccgcctcggacggcggctcgccgatcaccggg
tacgaggtctccacggacgacggggtcagctgggacaccctggccgcggacggcacggtc
accgggctgagcaacaacacgacgtacacgatccgggtccgcgcactcaatgccgccggg
cccggcccggccggcgccgccacctcggtcacaccggtcgacggcctgccgggcgcaccg
accgcgctggtcgcggcccgcggtgaccgcagcacgacgctgacgttcaccgcgcccgcc
gacccgggcagcagcgcgatcagcgggtacgaggtgtccaccgacaacggcgcgagctgg
gcggcactggcccccgatcgccgggtcaccggactggccaacggcacgacgtacacggtg
caggtccgggccgtcaacgacgccggcgccggcccggccagcggtggcgccacggtcacc
ccggccgccgcacccggtgcgcctgccgaagtccgggcctcacgcggcaaccgcagcgcg
accctgacgttcaccgcgccggtgaacgacggcggcgacccgatcaccggctatcaggtg
tccaccgacaacggcgcgacctgggtcaccctggccggcgaccggacggtcaccggactg
accaacggcaccacctatgccatccgggtccgggctgtcaacggcgtcggacccggcaca
ccgagcgccccggtgacggtcaccccggccacctcgtccggcgcgcccaccgccctggtc
gccgtccgcggcaacggcagcgcggccctgagcttcaccgcgccggacgacacgggcggc
gacccggtcaccggctaccaggtgtccaccgacaacggcgtcacctgggcttccctggcc
ggcgaccgtgtcgttaccgggctgaccaacggtgtcacctacacgatccgggttcgcgcg
gtgaacagctcgggtcccggcgccgcgagtgccccggccctcgtcactcccgccaccgcg
ccgggcatgccgaccggcctgtccgcgaccgccggcgacggcaccgcgacgctgatgttc
cgggcgcctgatgacggcggtgaccagatcaccggctacgaggtgtccgtcgacgacggc
accacctgggcggccctcgccggcgaccacatcgtcaccgggctgaccaacgcgacgacg
tacaccgtccggatccgggccctcaacagcgccgggaccggcccgccgagcgcttcggcg
acggtcacgccgatcgccggcgtgccgggcgcacccaccggcctgaccgccgtacgcggc
gacagcagcgtcacgctcacctggaccgcaccggccgacccgggcagcagcgcgatcacc
gggtacgacgtctccaccgacgccggtgtgacctggacggcgctggcgggcgacggcatc
gtcaccggcctcaccaacggcaccgcctacgacttctgggtccgtgcgcgcaacgccgtc
ggtcccggccccgcgagtgacagcgtcacggccacaccggcgaccacaccgcaggccccc
accgcgctgaccgccaaccccggcgacaccaccgtcaccctggcgttccgcgcaccggtg
gacgacggcggcgcagtgatcatcggatacgacgtgtccactgacgacggtggcacctgg
gcggccctgcccggcgaccgtacgatcaccggcctgaccaacggaaacgcctacaccatc
agggttcgcgccgtgaacgacgtcggcgccggacctgccggcgatcccgtgaccgccacc
ccgtcgcagggccgtccgggcgtggtcacggggctcagcgccaccgccgggaacacgacc
gccaccctgtccttcactgcaccggccgatccgggcagcagcgcgatcaccggctacgac
gtcacgatcgacggcggtgtgacgtggacgccgctggccgggaacagggtcgtcaccggc
ctcaccaacggcaccgcctatttcatcgccgtccgcgcccgcaacagcaccggcgccgga
ccggccggcgccgaggtgatggtgatccccgtgaccacctcggctgccccgaccgggctg
acggccgatgccggtgactccgtcgcgaccctcaccttcaccgcgcccgccgacaccggc
ggcgacccggtcaccggttacgaggtgtccaccgacaacggcaccacctggtccccgctg
accgtgtccgggacgaccacgctgaccggcaccgtcacgggcctgaccaacggaaccccc
tatcccgtacgcgtccgcgcgctcaccgctgccggccccggagcgccgagtgacagcgtc
acggtgacaccggcgaccgcggcggacgcaccggcctcgttcgccgtgaccgccggtgac
agcagcctccagctcatgttcagcccgcccgcctccgacggcggcaaccccgtcacgggg
tacgaggtctccgtcgacgacggcaccacctgggcggccgtcgcgggtgaccggatcgtc
accgggctgaccaacggcgtgacctaccaggtacgcgtccgggccgtcaccgccgccggg
cccggcgccgccaccgacgccgtcaccatcacaccggtcggcgggctgcccggcgcaccg
accgggctcagcgtcaccaggggcgaccggtcggccacggcgaccttcacaccaccggcc
gatccgggttcctcggcgatcaccggctacgaggtgtcgaccgacgacggctggaactgg
gcgccgctggccccgtccggtgtcatccccgcgctcaccaacggcaccacctacgtcgtc
cgcgtccgtgcggtcaacacgaccggcgccggaccggccggcgacggcgtcccggtcacc
ccggccgccgtcccgggcccgcccaccggcctgcgggtcacggcgggcgacaccacggca
acggtcgctttcaccgctcccgcggacgacggcggcgccgcgatcaccggctacgaggtc
tccaccgacaacggcgtcacctgggccgccctggcgaacgaccgccggatcccggggctc
accaacggaacgacctattccgtccgcgtacgcgcggtcaacgacgtgggtgccggtccg
gccggtgcggccgtgaccgtcacgccacgggcgttgcccggcgcacccaccgacgtcacc
gcgacaccggggaacgcctccgccacgatcgcgttcacaccaccggccgacggcggtgcc
accatcaccggctacgaggtctccaccgacaacggcgccacctggcgcagcctcgccgcc
aacggcacggtccccgacctgaccaacggaaccacctacaccgtgcggatccgggcccgg
aacagcgccggtgccgggccggccagcgccgcggtcaccgtcactcccgcagccgtgccc
ggcgcgcccacggacctgactgccgtacccggcgacggaacagcgacgctctcgttcacc
gcgccggccgcaggcggttccgcgatcaccggctacgacgtgtccaccgacgacggcgtg
acctgggcgccgctggccggcggggtggtcaccggcctgaccaacggtgacacgtacacc
gtgcgggtccgcgcccggaacagtgtcggggcgggtccggcgagcaacccggtgaccgtc
acgccggcgacagttcccgacgccccggccggtctgaccgccaccccgggcaacgcgtcg
atctcggtaaccttcagcccaccagcggacggcgggtcgccgatcaccgggtacgaggct
tcgagcaacaacggcaccacctggtcgccgctgaccgtgtccggggccaccaccaggacc
ggaacgctgaccgggctggacaacggcaccacgtacgccgtccgggtccgcgcccgcaac
agcgccggtgccggccccgcgagcgccaacgccacggccacacccacggcaggactcccg
ggtacgcccggcggcgtgtcggtggcccggggcaacgcgtcggcgaccgtcaccttcaca
cccggcggcggtacggtcaccggctaccaggtgtccaccgacgacggcgagacgtggcgg
accctgcccgccgacggcaccatcaccgggctgaccaacggcgtcacctacgccgtccgc
atccgggccgtcaacaacagcggcacctcggcggccagtccgagcgtcactgtcacgccg
gccaccaccccgggtgcgccgacccaggtgaccgccgtccgcggcgaccgcagtgccacc
ctgacgttcaccccgccggccggcgacggtggcgcgccgatcaccgggtacgagacctcc
gtcgacggcggcgacacctggaccgtcctcggtgacgacggtgtcgtgggcgggctcagc
aacgggacggcgtacaccatccgggtccgcgcccgcaacgatgtcggcgccggaccagcc
gctgtcgcaccaccggtcactcccgccgccggaccgggcgcacccacgggtgtgtccgcg
gtccccggtgacggccgtgtgacggtcacgttcactcccccggcatccgacggaggcagc
acgatcaccggctacgaggtgtcggtcgacaacgggaccacctgggctgcgctggccggg
accggcatcgtcaccgggctcacgaacggcacggcgtacacgatccgggtccgtgctctc
agcggcgccggcaccggaccggccagcgcggcggtcaccgtcacacccgcgaccgtgccc
gcctccccgaccggcctcagcgccgccccgggtgacgcctcggcgacggtcaccttcagc
ccgccgaacgccggtggcagccccatcacccggtacgagatctccaccgacgacggcgcc
tcgtgggccacactcgccgtggccggtaccggcgccacccgcaccggcatggtcgacggc
ctgaccaacggtgccgaggtgcaggtccgcgtccgggcccgcaacgacgtcggccccggc
gcaccgagcgcggccgtggccgtgacaccggtgaccgggttgccgtccgcgcccggcgac
gtgacggtcaccccgggcaacgcgtcggtctcgatcgcattcacaccacccacgggcggg
gtcaccagctacgaggtgtccatcgacgacggtgtcacctggaccaccctggccgggaac
ggcatcgtcgccgggctgaccaacgggaccgcgtacacggtccggatccgcgcccggaac
gcgaccggcgccggcccggcaagtcccggatacgtcacgacaccggcgaccacacccgcg
gcgccgaccgcgctgagcgccacccgcggaccgggatcggcgacgctgaccttcaccccg
ggtgcgaccggtggcacaccggtcacctcctacgagacgtcgatcgacggcggggcgacg
tggcagacgctgcaggccggcggcattgtcacgggcctgaccaacggcacggcgtacacg
atcgctgtccgcgcccgcaacgccgtcggggcgggcgcgatcgccacggtcaccgtcaca
cccgcgacgaccccgggtgcgcccacggcggtgaccgcggcccgcggtgatgcgtcggca
tccgtcgcgttcacggctccggcgtccacgggtggagccgccatcctgcgctacgaggtg
tcggtcgacaacggcaccacctgggccaccctggccggcaaccggatcgtcaccgggctc
acgaacgggaccgcgtacgcgatcaggctccgtgcggtcaacgaggtcggcgccggcgca
cccagcgcgacggcgagcgtcacccccgcgaccactccgggcgcgccgaccgcggtggct
gtctcacccggtgacgcctccgcctcggtgaacttcaccgcgcccgcctcgaccggtggg
gccgccatcaccggctaccaggtgtccaccgacaacggcaccacgtgggcagccctggcc
ggcaaccggatcgtcaccgggctcacgaacggcaccgcgtacctgatcagggttcgcgcg
gtcaacgaggtcggcaccggcgcacccagcgcggccacgacggtgacccccgcggtcgcg
ctgccgggcgcgccgaccgggctgaccgtcacccgcggggacggctcggccacggtggcc
ttcaccgcgggcggcggcgacccggtcagctacgaggtgtcggccgacggcggcgtgacc
tggacggcgctggccgccgaccgcgtcgtgaccggcctgaccaacggcaccacctacgcg
atcgccgtccgcgcggtcaaccccgccggcgccggacccgccaccccggcggtcacggtc
accccggcgacgctgcccggcgcaccgacgctgggctcggtcgtcttcaccaccaccagc
gtcaccatcacgttcaccgcgcccgccaccgacggcggcagccctgtcaccgcctacgag
ctctccctcgacggcggcgcaaccttcaaccccgtcacccccaccggtacgggcacactg
acggtcaccgtcaccggcctgaccagcggaaccgtgtacgcggtggccctgcgcgcccgc
aacgccgtcggcgccggaccggccgacagcgagttcgccgcgtccaccccgcccgccgca
ccgacccagctggcggtgacccgcggcgacgcgtccgccaccctcaccttcaccccgccc
gacgacgagacgatcaccggatatcaggtgtccaccgacaacggcgcgacctggaccgac
ctcgccgtcgagggcacctcaccgctgaccgccacggtgaccggcctcgacaacaccagc
acgtaccgcttccgcgtgcgggcggtcaacgaggccggccccggacgggccagcgacgcc
gtcacgtccacggtcgccacggcaccgggtgcaccccaggctgtgaccgccaccgggcgt
acgtcgtcgatcctcgtgacgtgggcgccgccggacaacagcccggtgcccgtcaccggg
taccgggccgtggcctcccccgggccggccacgtgcaccaccggacccagcgagacgtcc
tgtgtgctcggcggccgggccggagtcgagtacaccgtgcgggtggtcgccctcagcacc
ggcggctcgacaacctccaccgcatcagccaccgcgacgccggtcgcaccgtccctgccc
accgcaccgccgtcgtccgcgccgtcgctgaccacggccgacggcgatatcaccacggcc
gtacccgggcaggagatcgtgctcgtcggcgacggcttcgcgccgcactcgacggtccag
atcgcggtctactccaagccgcagctgctcgacacggtcgtgaccgatgccgacggctcg
ttccggaagctcgtccgcctcccggccggcctggctgccggacagcacacactgctggcc
accggcgtcgaccccgacgggaacgtgctggtccgcacgctgagcgtgaccgtaaaggcc
gcgacgtccgcacccacggccccatcagtcgacccggagccgggcacttccatgccgaag
accggccagaacatcgccctcgtggccgccctcggcctcctgatgatctgcgtcggcacc
ggcctggtcctcgtccgccgcgaccgccgctga

DBGET integrated database retrieval system