KEGG   Actinoplanes friuliensis: AFR_26140Help
Entry
AFR_26140         CDS       T02892                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00053  Ascorbate and aldarate metabolism
afs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    AFR_26140
Enzymes [BR:afs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     AFR_26140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_10 3Beta_HSD GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind NmrA
Motif
Other DBs
NCBI-ProteinID: AGZ43490
UniProt: U5W660
Position
complement(5678188..5679012)
Genome map
AA seq 274 aa AA seqDB search
MAQRLLITGGSGKVATSLRPRLAAPGRTLRLLDIVAPAPVDGSGDEEVVIASVDDLDALT
AAFADVDAIVHLGGQSKESDAEDVLRLNAYGTYCVLEAARRAGVKRVVLASSSHAVGFHE
RDDSYPDGLPADLPPRPDTLYGWSKTAVESLGRLYVDRFGLDVICLRIGLWFPTPPQLRG
LALWLSPDDGARLVEACVAVEHPGYRIVWGVSRNTRRWWSLAEGEAIGYFPKDDAEIFAE
RYVAEFGEPDFEHDPLLNRVGSYWCDHPLGQRMG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcgactcctcatcaccggcggctcgggcaaggtggcgacctcgttgcgcccg
cgcctggccgccccggggcgcacgctgcgactgctggacatcgtggcgccggcgccggtc
gacgggagcggcgacgaggaggtggtcatcgcctcggtggacgacctcgacgccctgacc
gcggcgttcgcggacgtggacgcgatcgtccacctgggtgggcagagcaaggagtccgac
gccgaggacgtgctgcggctcaacgcgtacgggacctattgtgtcctggaggcggcccgc
cgcgccggggtgaagcgggttgtcctggcgtcgtcgagtcatgccgtcggtttccacgag
cgcgacgacagctaccccgacgggctcccggccgacctcccgccccgccccgacaccctg
tacggctggagcaagaccgccgtcgagtcgctgggccgcctgtacgtggaccgcttcggc
ctggacgtgatctgcctgcgcatcggcctgtggttcccgacgccgccgcagctgcgcggg
ctggccctctggctgtcacccgacgacggcgcccggctggtcgaggcctgtgtcgccgtc
gagcatccgggatatcggatcgtctggggtgtcagccgcaacacccgccgctggtggtca
ctggccgagggcgaggcgatcggctacttcccgaaggacgacgccgagatcttcgcggag
cggtacgtggcggagttcggcgagcccgacttcgagcacgacccgctgttgaaccgcgtc
ggctcgtactggtgcgaccacccgctcggtcagcgtatgggctag

DBGET integrated database retrieval system