KEGG   Actinoplanes friuliensis: AFR_36275Help
Entry
AFR_36275         CDS       T02892                                 

Definition
(GenBank) putative aminotransferase
  KO
K04127  isopenicillin-N epimerase [EC:5.1.1.17]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00311  Penicillin and cephalosporin biosynthesis
afs01100  Metabolic pathways
afs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afs00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    AFR_36275
Enzymes [BR:afs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.17  isopenicillin-N epimerase
     AFR_36275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-ProteinID: AGZ45511
UniProt: U5WC25
Position
7927202..7928389
Genome map
AA seq 395 aa AA seqDB search
MSVGDPPPAIPGARLLFSLDAATAYLNHGSFGAVPIGVQRAQQRLRDEIDRNPMSFFVHP
GLTDRIVHTRRHLAAFLGADPDGSALVPNVTAAVSLVLQSVRLTSGDEVLLTDHGYGANA
FAVRRQCRRDGATARTVALPLDATDAEVVSRIRNALRPGKTKLLVVDQITSPTAKVLPVR
EIAAAAREHDIPVLVDAAHVPGMLDVDVERIGADFWVGNLHKWAFAPRSTALLAVAPAWR
RRIEPLIVSWEQESGFPMAVEFQGTIDYTPWLAAPAGLFTLRTLGLDTVRAHNAALAAYG
QRVVGESLGLAPTDLPDPGAAEASMRILPLPSGLATTQPEAHALRQMVADKLATEVAINA
WGGRGWLRLSAQVYNRPDEFENLAERLPPLLAGLR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcggagatccgcccccggccatcccgggagcgcggctcctcttctccctggat
gcggccaccgcctatctcaaccacggctcgttcggcgccgtcccgatcggggtgcagcgt
gcccagcagcggctgcgggacgagatcgaccgcaatccgatgtcgttcttcgtgcatccg
gggctgaccgaccggatcgtccatacgcgacggcatctcgcggcttttctgggtgcggac
ccggacggcagcgccctggtgccgaacgtgaccgcggccgtctccctggtgctgcagtcg
gtgcggctcacctccggtgacgaggtgctgctcaccgatcacgggtacggcgcgaacgct
tttgcggtgcggcggcagtgccggcgtgacggggccacggcgcggacggtcgccctgccg
ctggacgcaaccgacgccgaggtcgtctcccgcatccgcaacgcgttgcgccccggcaag
accaagctcctggtcgtcgaccagatcacctcccccaccgccaaggtccttccggtacgc
gagatcgccgcggccgcccgtgagcacgacatccccgtgctcgtcgacgcggcgcacgtg
ccggggatgctcgacgtcgacgtggagcggatcggcgccgatttctgggtggggaacctg
cacaagtgggccttcgccccccggagcaccgcgctgctggcggtggcgccggcctggcgc
cgccgcatcgagccgctgatcgtctcgtgggagcaggagtcgggtttcccgatggcggtg
gagttccaggggacgatcgattacacgccgtggctcgccgcacccgccggcctcttcacc
ctgcgcactctcgggctcgacacggtccgggcgcacaacgcggccctggcggcgtacggg
cagagggttgtcggtgagagcctcggtctcgcgccgaccgacctgccggacccgggcgcg
gccgaggcgtccatgcggatcctgccgttgccgagcgggctcgccaccacgcagccggag
gcgcacgcgctgcggcagatggtcgccgacaagctggccaccgaggtggcgatcaacgcc
tggggcggtcgtggctggctccggctgagcgcgcaggtctacaaccgcccggacgagttc
gagaacctcgcggaacgcctgccgcccctgctcgccgggctgcgctga

DBGET integrated database retrieval system