KEGG   Actinoplanes friuliensis: AFR_41305Help
Entry
AFR_41305         CDS       T02892                                 

Definition
(GenBank) 3-demethylubiquinone-9 3-methyltransferase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00130  Ubiquinone and other terpenoid-quinone biosynthesis
afs01100  Metabolic pathways
afs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AFR_41305
Enzymes [BR:afs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     AFR_41305
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     AFR_41305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_31 Methyltransf_12 Methyltransf_8 Ubie_methyltran AdoMet_MTase PrmA MetW Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AGZ46515
UniProt: U5WEP7
Position
complement(8998274..8998993)
Genome map
AA seq 239 aa AA seqDB search
MLPRNDPRQYDDLAGEWWRPGGHFEILHWLAAARGALVPRAERPEAVLVDAGCGGGLLAP
HVQRLGYRHVGVDLRRSGLEQSASRGVTPVTGDVTALPLADGAADVVVAGEILEHVTDLP
GTVAELCRVLRPGGLLVLDTVNDTPVGRFVTVTLGERFGAAPVGIHDPELFVDPGELTAE
CAKHGVRLQVRGLRPSTIGLVRWLFLPKGTRSRPLGRMIPTRSTAVVYQGMGRKQGESR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
ttgctcccccgcaacgacccccgtcagtacgacgacctggcgggtgagtggtggcggccc
gggggacacttcgagatcctgcactggctggcggctgcgcggggtgcgctggtgccgcgg
gccgagcgcccggaggcggtcctggtcgacgccggctgcggcggtggtctgctggcgccg
cacgtgcagcggctcggttaccggcacgtcggcgtggatctccgtcgctcgggcctggag
cagtcggcgagccggggtgtgactccggtgacaggtgacgtgacggcgctcccgctggcc
gacggcgcggccgacgtcgtggtcgccggcgagatcctcgagcacgtcaccgacctgccg
ggcacggtcgccgagctgtgccgggtgctgcgcccgggcgggctgctcgtcctcgacacg
gtcaacgacaccccggtggggcggttcgtcacggtcacgctcggcgagcgcttcggtgcg
gctccggtcgggatccacgacccggagctgttcgtcgacccgggtgagctgaccgccgag
tgcgccaagcacggcgtacgcctgcaggtccgtggtctgcgcccgagcacgatcgggctg
gtcaggtggttattcctgccgaagggcacccggtcgcgcccgctgggacggatgatcccg
acccggtccaccgcggtcgtctaccagggcatgggacgcaaacagggggagagcagatga

DBGET integrated database retrieval system