KEGG   Anoxybacter fermentans: BBF96_02705Help
Entry
BBF96_02705       CDS       T05768                                 

Definition
(GenBank) riboflavin biosynthesis protein RibF
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
aft  Anoxybacter fermentans
Pathway
aft00740  Riboflavin metabolism
aft01100  Metabolic pathways
aft01110  Biosynthesis of secondary metabolites
Module
aft_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:aft00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BBF96_02705
Enzymes [BR:aft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     BBF96_02705
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     BBF96_02705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AZR72397
UniProt: A0A3Q9HP50
Position
608452..609396
Genome map
AA seq 314 aa AA seqDB search
MQLITDEEIMKNHDKPMIVALGFFDGIHYGHRVIIEETVRQARESNVLSGVFTFHPHPLK
VLAPKRAPGLITALSQKRRILAEMGVDRLIVKAFTKEFAATDFRSFVQTYLVQYLKVKGV
VVGEDFRFGKESKGDATAMKELGEKYGFTVTVFDTIRVNGVEVRSTLIRNLILKGQMDKL
LTYLGRPYTLVGKVVRGDGRGHQLGFPTANLSLAVDYVIPDYGVYAGYIIVHGKRYQAVA
NIGVRPTFAKSDLSIEIHILDYSGNLYDEIVEIELIKKIRSERSFDSIDELVAQIKDDIV
STRQILSNDITAKS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgattacagatgaagaaataatgaaaaatcacgataaacctatgatagttgcc
ctgggtttttttgacggtattcattacggacatcgtgttatcatagaagagacagttcgt
caggccagagagtcaaatgtcttgagcggagtttttacttttcatcctcatcctttaaag
gttctggcaccgaagcgggctcccggattaattacagctttatctcaaaaaaggcggatt
ttagctgaaatgggtgttgaccgactaattgtaaaagcttttactaaagaatttgctgcc
actgatttccgttcttttgttcagacctatctggttcaatatttaaaggtaaaaggtgtt
gttgtgggagaagattttcgttttggtaaggaaagtaaaggcgatgctactgctatgaag
gaattgggcgaaaaatacggttttactgtaactgtctttgatactattagggtaaatggg
gtagaagttagaagcactttgattcgcaatttgattcttaaaggtcagatggataagctc
cttacttatttaggaagaccgtatactttggttggtaaagttgttcggggagatggccgc
ggtcatcaattgggatttcctacagcaaatttatcattagcagttgattatgttattcct
gattacggagtatatgccgggtatattattgttcatggtaaaagatatcaagctgttgct
aatatcggagtcaggcctacttttgctaaatccgatctttctattgaaattcatattctg
gactattcagggaatttatacgatgagatagttgagattgaattgatcaaaaaaatacgt
tctgagcgttcttttgattcaattgatgagctggtggctcaaattaaagatgatattgta
tcaacccgtcaaattttatcaaatgacattactgcaaaaagttga

DBGET integrated database retrieval system