KEGG   Anoxybacter fermentans: BBF96_03165Help
Entry
BBF96_03165       CDS       T05768                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
aft  Anoxybacter fermentans
Pathway
aft00620  Pyruvate metabolism
aft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBF96_03165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aft02000]
    BBF96_03165
Enzymes [BR:aft01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BBF96_03165
Transporters [BR:aft02000]
 Other transporters
  Primary active transporters [TC:3]
   BBF96_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: AZR72467
UniProt: A0A3Q9HP66
Position
699241..700572
Genome map
AA seq 443 aa AA seqDB search
MAKQVKITETVLRDGHQSLMATRMRTEDMLPVAAELDEVGYASLEVWGGATFDSCLRFLN
EDPWERLRSLKKVIKKTPLQMLLRGQNLLGYRHYPDDVVERFVKKSVENGIDIIRIFDAL
NDVRNLEVAIRATKEAGAHAQGCIVYTTSPVHDISMYLELAHKLKDMGVDSICIKDMAGL
LTPQVAYELVSRIKKEIDLPLQLHCHYTSGLAAVTYMKAIEAGVDIIDTAFSSFALSTSQ
PATETMVAILAETEYDTGIDLEKVSMLNRHFKDVKKKREEFVAVSGIDPEVLVYQIPGGM
LSNLRNALRQQKMLDKYEEVLKEVPRIREELGYPPLVTPMSQIVGTQAVFNVITGKRYQV
KSKEIKDYVKGLYGKSPGPISEEFRKQIIGDEEPITCRPADLLSPIYEKKAEEIKDLARS
EEDVLSYILFPEPALNFFKKRNG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaacaggtgaaaattacagaaacagttcttagagacggtcatcaatctttgatg
gcaaccaggatgagaactgaagatatgcttcctgttgcagcagaactggatgaagttggt
tatgcttctctggaagtctggggaggggctacctttgatagctgtcttagatttttaaat
gaagatccctgggaacggcttcgttctttaaagaaagtaatcaaaaaaacaccattacaa
atgcttttgaggggacaaaatcttttaggataccgtcattatcctgatgatgtggtggaa
cgttttgttaagaaatctgtagaaaacggaattgatattatccgaatctttgatgcttta
aatgatgtgcgtaatctggaggtcgcaattcgagcaaccaaagaagcaggagcacatgct
cagggttgtatagtatatacaaccagtcctgtacatgatatttctatgtatttagagctg
gcccataagttaaaagatatgggagttgattctatctgtattaaagatatggctggactt
ttaactccccaggtagcatatgaactggttagccggattaaaaaagagattgatttgcca
ctccaactccactgccattataccagcggattagctgctgtaacttatatgaaggctata
gaggcaggagtggatataatcgatacagctttctccagttttgctctttcaacatcacaa
cctgccactgagactatggtagcaattttggcggaaacggaatatgatacagggattgat
ctggaaaaagtatctatgctaaatcggcattttaaagatgttaagaagaaaagagaagaa
tttgtagctgttagtggtatcgatccagaggtattggtttatcaaattcctggtggaatg
ctttctaatttaaggaatgctcttcgacagcaaaagatgctggacaaatatgaagaggtt
ttaaaagaggtacctcgaattagggaggaactgggctatccgcctcttgtaacaccaatg
agtcagatagttggtacccaggcagttttcaatgtcattactggcaagcgttatcaagtt
aagtccaaagagatcaaagattatgtaaaaggattgtatggtaaatcccctgggccaatc
tctgaagagtttcgtaaacagattattggtgatgaggaaccaattacctgtagaccagca
gatttactctcacctatatatgagaagaaagcagaagaaattaaagatctagcccgtagt
gaagaagatgtgctttcatatattctcttccctgagcccgctttaaacttttttaagaag
cgaaatgggtaa

DBGET integrated database retrieval system