KEGG   Anoxybacter fermentans: BBF96_04350Help
Entry
BBF96_04350       CDS       T05768                                 

Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
aft  Anoxybacter fermentans
Pathway
aft00670  One carbon pool by folate
aft01100  Metabolic pathways
aft01120  Microbial metabolism in diverse environments
aft01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aft00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BBF96_04350
Enzymes [BR:aft01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BBF96_04350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Mis12
Motif
Other DBs
NCBI-ProteinID: AZR72688
UniProt: A0A3S9SWP1
Position
976149..977027
Genome map
AA seq 292 aa AA seqDB search
MGERIIDVIHKKGITLSFEVFPPKKSQDRDLSIIFGTIEKLVDLKPDFISVTYGAGGGNK
SRASEISQFIQTTTNSIALAHLTCVGYLKKDIKEILDKFYSIGVRNILALRGDIPAGVTF
PHDAWQDFQYAKDLIQLIKEDGRFCIGAAAYPEGHVQCKDLKKTIKHMKAKIEAGADFFI
TQLFFENELFYKFMDMVESAGITAPVIPGIMPVLRAKQIKRIVELTGASIPVKLNRLLEK
YENKPEEMEKAGIEYALAQVEDLIETGVKGIHLYTMNKARQACEIVKKAGLR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgggagagagaattattgatgtgatccataaaaaaggtataactttatcctttgaagtc
tttccccccaaaaagtctcaggatagagatttaagcattatttttggaactattgaaaaa
ttagtggatctaaagcctgattttataagtgttacctatggagcaggtgggggaaacaaa
tcccgggccagcgaaatatcccaattcatccagactaccaccaattctattgccctggcc
catttaacctgtgttggttatttgaaaaaggacatcaaagaaattttagataaattctat
tccattggtgttcgcaatatcctcgcattgcggggagatattcccgcaggagttactttt
cctcatgatgcatggcaggactttcaatatgcaaaagacttaattcagcttattaaagaa
gatgggcgcttctgtattggagctgctgcttatccggaagggcatgtccaatgtaaagat
cttaaaaaaaccattaaacatatgaaagcgaaaatagaagccggtgcggatttttttata
acccagctcttttttgaaaatgaacttttttataaatttatggatatggtggagagtgca
gggattacagcacctgtgattcctggaattatgccagttttaagagcaaaacagatcaag
cgtattgtagaactaacaggtgccagcattcctgtaaaacttaataggcttttagagaaa
tatgaaaataaaccggaagagatggagaaggcaggtattgagtatgcactggctcaggtt
gaagatcttattgagacaggtgtaaaaggaattcatctatacactatgaacaaggccaga
caggcctgtgaaatagtaaagaaagcaggattaaggtag

DBGET integrated database retrieval system