KEGG   Anoxybacter fermentans: BBF96_05910Help
Entry
BBF96_05910       CDS       T05768                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aft  Anoxybacter fermentans
Pathway
aft00450  Selenocompound metabolism
aft00970  Aminoacyl-tRNA biosynthesis
aft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aft00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BBF96_05910
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBF96_05910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aft01007]
    BBF96_05910
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aft03016]
    BBF96_05910
Enzymes [BR:aft01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BBF96_05910
Amino acid related enzymes [BR:aft01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BBF96_05910
Transfer RNA biogenesis [BR:aft03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BBF96_05910
 Prokaryotic type
   Other AARSs
    BBF96_05910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 TackOD1 zinc-ribbons_6 zf_C2H2_10 C1_1
Motif
Other DBs
NCBI-ProteinID: AZR72969
UniProt: A0A3S9SXE5
Position
complement(1335269..1336936)
Genome map
AA seq 555 aa AA seqDB search
MTKLRNRNKNVFIGGAWPYANGSLHLGHIAALLPGDVIAKYYRLTGANVLYVSGSDCHGT
PISVKAANEGVEPQNIAGTYHNEFKNTFEKLGFDYDIYTNTMEDFHKEKVQEFIKQLYRN
DLLYSKEVKQAFCPKCNRFLPDRYITGTCYNCGAAGARGDQCDVCGSLIEVEYLTDKKCT
VCHTEPVVKDVEHLFIKLSKFQDKIAELVDKNEDKWRANAINLTRRYLREGIKDRAISRD
LDWGISVPIKGYEDKKIYVWFEAVLGYLTASMKWAKERGNEDLWKDFWNDSVISYYIHGK
DNIPFHTIIFPALLMGLGIQSLPSHIISSEYLTIEGKRLSTSRNWAIWAEDFLSRYDADP
LRYFLIINGPEKRDSDFSWSEFLERNNGELLGAYGNLINRTLALVIKGFGKVVPTPAEYT
SEDYAILNLCKGLYTKVGELIEKGELKEALKEIFEVIRASNKYFDVQTPWLTVKSDKEKA
ATTLKVCLDLILNLSNLCYPFVPGIATKALAFLNCSPSWEYSELTAGSPINEPYILVKKL
DKKIIEEEVARLGKE
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgactaagttaagaaatcgtaacaagaatgtttttattggaggagcctggccttatgca
aatgggtcattgcatttaggtcatattgctgcattgttgccgggagatgtaattgctaaa
tattataggctaactggtgcaaatgttttatatgtatcaggctctgactgccatggaact
cctatatctgttaaagcagccaatgaaggagtggaaccacagaacatagctggtacatat
cacaatgaatttaagaatacatttgaaaaattgggctttgactatgatatatacacaaat
acaatggaagattttcataaggaaaaagttcaagaatttataaagcaattatatcgtaat
gatttgctctattcaaaagaggtcaaacaagctttctgccctaagtgtaacagattttta
cctgatcgatatataactggtacctgttataattgtggagcggcaggagcaagaggtgac
caatgtgatgtatgtggttcattaattgaagttgaatatttaacagataaaaaatgtaca
gtctgtcacactgaacctgttgtaaaagatgtagaacatttatttataaagctctctaaa
ttccaggataaaattgcagaacttgttgacaaaaatgaagataagtggagagctaacgcg
attaacttaacaaggagatatttaagagaaggtataaaagatcgggcaatatccagagac
cttgactggggtattagtgttccaatcaagggatatgaagataaaaaaatctacgtttgg
tttgaagcagtattgggttatttaactgcaagtatgaaatgggcaaaagaaagaggtaat
gaagacctctggaaagatttttggaatgattctgtcatctcatattatattcacggtaag
gacaatataccatttcatacaattatttttccagcccttttgatgggactgggaattcaa
tcattaccttcacacatcatatccagtgaatatttaacaatagaaggcaaaaggctgtca
actagtagaaattgggctatatgggcagaagattttttgagtagatatgatgctgatcca
ttaagatacttcttaattataaatgggcctgaaaagagagatagtgatttttcctggagt
gaatttctcgaaagaaataatggtgaattattaggagcatatggtaacttaataaatagg
actcttgctttagtaattaaaggttttggtaaagtcgttccaactccagccgagtacacc
agtgaggattatgccattttaaatttatgtaaaggtttatatacaaaggttggagagtta
attgaaaagggagaattaaaagaggcactgaaagaaatttttgaagttattcgtgcaagt
aataaatattttgatgtccaaactccgtggttgacagtgaagtcagacaaagagaaagct
gcaaccaccttaaaagtttgtttggatctcatacttaacctatctaatttgtgctatcca
tttgtcccgggtattgctacaaaagctttagcatttttgaattgttctccgagttgggaa
tatagtgagttgactgctggttcgccaatcaatgagccttacattctcgttaaaaagctg
gataaaaagattattgaagaggaagttgcaagacttggaaaagagtag

DBGET integrated database retrieval system