KEGG   Anoxybacter fermentans: BBF96_11430Help
Entry
BBF96_11430       CDS       T05768                                 

Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
aft  Anoxybacter fermentans
Pathway
aft00540  Lipopolysaccharide biosynthesis
aft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aft00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BBF96_11430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aft01003]
    BBF96_11430
   01005 Lipopolysaccharide biosynthesis proteins [BR:aft01005]
    BBF96_11430
Enzymes [BR:aft01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     BBF96_11430
Glycosyltransferases [BR:aft01003]
 Polysaccharide
  Bacterial polysaccharide
   BBF96_11430
Lipopolysaccharide biosynthesis proteins [BR:aft01005]
 Lipid A
  BBF96_11430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB Epimerase_2 Nbs1_C DUF354 PTPS
Motif
Other DBs
NCBI-ProteinID: AZR73948
UniProt: A0A3S9T063
Position
complement(2526803..2527960)
Genome map
AA seq 385 aa AA seqDB search
MFKIMVVAGEVSGDMQAARVIRVLKKKRSDLSFIGMGGKEMLKEGVKILFDPTQLSTIGF
VEALKHLRKFYQLLDMLSRVIDEEKPDLLFLVDYSGFNMKMAKIGQKKGVPVVNYFSPSA
WVWGEWRAYKMAKWGAKIAAVFPMEVDVYKKAGADVTFVGHPLLDFVSPTMSSEEFRNFL
GLKETDPIIGLLPGSRKGEILSLLPPMIEAARLIHKRMPQIRFVLPLASPVFKDLVTSII
KDAANELPLYLTIGHAYEVMDNAELILCASGTATLEAACLKVPMIIAYKTSLSTYFLGKL
LAKVKFVGLPNIIAGKEIVPEFLQRNVTGENLARAAFEILENRAKKEEIEDELAKVRTAL
GAKGAVERVADLILRTLEENTAGEK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaattatggttgttgctggtgaagtttccggcgatatgcaggcagcccgggta
attcgtgttcttaaaaagaaaaggtcagatttgtcatttatagggatggggggaaaagag
atgctaaaagagggagttaaaattctctttgaccccacccagcttagtactattggcttt
gttgaggctttaaaacatttgcgtaaattttatcagctattggacatgttaagccgagta
attgatgaagagaagccagatcttctttttttagtagattactcgggctttaatatgaaa
atggcaaagataggacagaaaaagggtgtgccggtggtcaattattttagtccttcagca
tgggtctggggcgaatggcgtgcttataagatggcaaaatggggggcaaaaattgccgct
gtttttcctatggaagtagatgtctataaaaaggcaggtgctgatgttacttttgtagga
catccactgttggattttgtatcacctacgatgtcttcagaggaattccgtaatttctta
ggtttaaaagagactgatcctattattggtttactgcccgggagtcgtaaaggtgagatt
ttatctttactgccgccaatgattgaagcagcacggctaatccataaaaggatgccgcaa
attcgttttgtgttacctttggcttcacctgtctttaaggatctggttacttccatcata
aaagatgcggctaatgaacttccattatatttgactatcggtcatgcctatgaagtgatg
gataatgcagaactgattttatgtgcatcgggaactgcaactttagaagcagcctgtctt
aaagttcccatgattattgcatataagacttcattgagcacgtattttttgggtaaacta
ttggcgaaagttaagtttgttggtttgcccaatataattgcaggaaaagagatagttcct
gaatttctgcagaggaatgttactggggagaatctggcccgggctgcctttgagatatta
gagaatcgggcaaaaaaagaagagatagaggatgagttggctaaagttcgtacagcttta
ggggccaaaggagcagttgaacgggtagctgatctgattttaaggacattagaggaaaac
accgctggagaaaagtaa

DBGET integrated database retrieval system