KEGG   Anoxybacter fermentans: BBF96_13580
Entry
BBF96_13580       CDS       T05768                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
aft  Anoxybacter fermentans
Pathway
aft00472  D-Arginine and D-ornithine metabolism
aft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aft00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BBF96_13580
Enzymes [BR:aft01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     BBF96_13580
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AZR74330
UniProt: A0A3Q9HRW8
Position
3020176..3020547
AA seq 123 aa
MAEERRDDFQERRKHLANLSDEELHQRFWELAEKIVDPLIDLAYKHTSPSIERSVLLRMG
LSSLEAKDLVQMISERDLLGKGAGHIVWKIAKEKGLGIREAGQALIEGKYWDDVEAIFRG
GGK
NT seq 372 nt   +upstreamnt  +downstreamnt
atggcagaggaaagacgggatgattttcaagaacgtcgtaaacatctggctaatttaagt
gatgaagaacttcatcaacgtttctgggagttggcggagaagattgtcgatccgctgata
gatctggcttataagcatacttccccatctattgagaggtctgtgcttctaaggatgggt
ttgagtagtctggaagctaaggacctggtacagatgatctctgaaagagacctattaggt
aaaggtgcaggacatattgtctggaaaattgcaaaagaaaaaggcttaggaatccgtgaa
gcaggtcaggctttaattgagggtaaatattgggatgatgtagaggcaatctttagagga
ggtggaaagtga

DBGET integrated database retrieval system