KEGG   Anoxybacter fermentans: BBF96_13585
Entry
BBF96_13585       CDS       T05768                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
aft  Anoxybacter fermentans
Pathway
aft00472  D-Arginine and D-ornithine metabolism
aft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aft00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BBF96_13585
Enzymes [BR:aft01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     BBF96_13585
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AZR74331
UniProt: A0A3Q9HU05
Position
3020547..3022745
AA seq 732 aa
MKLDPNKKINIDELLQDLENYRPRRKGWTWRKKTDKPVKKGPFTYYQVSEDLKNSIPLPA
AKSFGNIDPQPDCVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTMGQSHFDGLIEGT
PEGVGGVPISRKQIRASRKALDMIEDEVGRPINFHSYVSGVAGPEVATLFAEEGVNGAHQ
DPQYNVLYRNVNMIRSFVDAAVAKKLMAGANMLQIDGAHNANATAREAWKVMPELLVQHA
INSMFSIKAGMKKENIALSTVPPTAPPAPCMRLDLPYAVALRELFKGFKFRAQMNTKYME
SCTREATVTHVLNLMISRLTSADIQSTITPDEGRNVPWHYNNIHAINTAKQALIGMDGLM
EMIELKKDGYLREKVREIKERAVLFLEEILEKGGYFKAVEDGFFVDSGYYPERNGDGISR
QIDGGVGAGTVVPRDDDYMAPVCDHFGYNNLPENIENPCDLIDGCTLCKPEKIVFIDELD
PEDNVYKRLEKTKGVRGDDCLIKPEVEWAGDGWVNIVLFLPVEERIAEAAALEIAKKMGL
KNVEVIHKQQMHPSEGTFLEVKGQIEFTIDPKELVIPEEEELLDDDTIRANIKAKPMRVV
AATVGEDEHSVGMREIIDIKHGGIEKYGIKCTYLGTSVPIEKVVNAAIEVNAEAILISTI
ITHNDVHRTNMKKLHDLCVEKGIRDKVCLIAGGTQVTNDIAIECGMDAGFGRGTKGHHVA
SFLVKHRMEKKK
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgaagttagatccaaataaaaagattaatattgatgaactgttgcaggatctggaaaac
tataggccgcggcgtaaaggctggacctggcgtaaaaaaacagataagccagtaaaaaaa
ggaccttttacttactatcaggtatctgaagatttaaaaaatagtattccattacctgct
gccaaaagctttggcaatattgatccacaacctgattgtgttattactacagagattgct
tccggtagatttgaagatgatattcgtcgaatgcggatggctgcctggcatggtgcagac
catataatggttatcagaacaatgggccagagccatttcgatggtttaattgaaggtact
ccagaaggagttggtggtgtacccataagtcgtaagcagattagagccagccggaaagct
ctggatatgattgaagatgaagtaggtcggccgattaatttccactcttacgtcagtggt
gtagcggggccagaggtagctactctttttgctgaagaaggagtaaatggggctcatcag
gacccgcaatataatgttctttaccggaatgtaaacatgattcgttcctttgtagatgca
gcggtagctaaaaaattaatggcaggggctaatatgctccagattgatggtgctcataat
gccaatgccactgcacgtgaagcatggaaggttatgcctgaacttttagttcagcacgca
ataaattcgatgttttctataaaggctggaatgaagaaagagaatattgctctttcaact
gtaccaccaacagctcctccggcaccatgtatgaggttagatttaccttatgcagttgct
ttaagagaactttttaaagggtttaaatttagggcccagatgaacaccaaatatatggag
tcctgtacccgggaagctactgtaacccatgtgctaaatctgatgatttcacggttaact
tctgctgatatacaaagtaccattacccctgatgaagggcgaaatgtgccctggcattat
aataacatccatgctatcaatactgctaaacaggcattaattggtatggatggtttaatg
gagatgattgaacttaaaaaagatggatatctccgtgaaaaggtaagagaaattaaagaa
agggctgttctcttcttagaagaaattttagaaaaaggcggatatttcaaggcagtagaa
gatggcttttttgtagattctggttattatcctgagcgaaatggtgacggaatttcccgt
caaattgatggcggtgtaggtgctggtactgttgtaccgcgggatgatgattatatggca
ccggtctgtgaccattttggttacaataacctgcctgaaaatattgaaaatccctgtgat
ttgattgatggatgtactctctgtaaaccagaaaagattgtctttattgatgaacttgac
ccagaggataatgtttataaacgtttagagaaaacaaagggtgttcgcggtgatgattgt
ctgattaaaccggaggtagaatgggccggtgatggttgggtaaatatagttctcttctta
cctgtagaagaacggattgcagaagcagcagctttagagatagcaaagaagatgggctta
aagaatgtagaagtaattcataaacagcaaatgcatccatctgaaggtacttttcttgag
gtcaaaggtcagatagagtttaccattgatccaaaagaactggtaattccagaagaagaa
gaattattggatgatgatacaattagagccaatattaaggcaaaaccaatgcgcgttgtt
gctgcaactgttggggaagatgagcattctgtaggtatgagagagattattgatattaaa
catggtggtattgaaaaatatggtattaagtgtacctatctgggaacttctgtacccatc
gaaaaagttgtaaatgccgccattgaagtgaatgcagaagcaattcttatcagtaccatt
attacccataatgatgttcaccgtacaaatatgaagaaacttcacgatctctgtgtagaa
aaaggaatcagggataaagtctgtctgattgctggcggtactcaggtgaccaatgatatt
gctattgagtgtggtatggatgctggttttggtcgcggtactaaaggacatcatgtagca
agcttccttgttaaacatcgtatggagaaaaagaagtaa

DBGET integrated database retrieval system