KEGG   Archaeoglobus fulgidus DSM 4304: AF_0927Help
Entry
AF_0927           CDS       T00011                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09722  4-phosphopantoate---beta-alanine ligase [EC:6.3.2.36]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
afu00410  beta-Alanine metabolism
afu00770  Pantothenate and CoA biosynthesis
afu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AF_0927
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AF_0927
Enzymes [BR:afu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.36  4-phosphopantoate---beta-alanine ligase
     AF_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPS_PS DUF2007 Sigma70_r1_1 BORCS8 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AAB90316
UniProt: O29335
Position
complement(827095..827661)
Genome map
AA seq 188 aa AA seqDB search
MLLAKHPVISVNGNTAVLVPEETRKLAELVNAKVEINVFHHSPERVEKIKRYLEKHGIEV
LAAGDAVLEGLESARRIVDSRGILIADVVLVPLEDGDRCEILKRHGKKVIAIDLNPLSRT
ARMADITIVDNIIRAFPKMVEMAEEMRKWERERLKEVVENYDNSKVLAEAVEGIIQYLQK
VKGELLSP
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggcaaagcatcccgtaatctccgttaatgggaatacagcggtgctcgttcca
gaagagacgaggaagcttgcagagctcgtaaatgcaaaggtggagattaacgttttccac
cacagccccgagagagtggagaagattaaacgctaccttgaaaagcacggaattgaggtt
ctcgctgcaggagatgcggtgcttgagggccttgagtcggcgagaaggatagttgacagc
agggggattctcatcgctgacgtcgtgcttgtgcccttggaggatggtgacaggtgcgag
attctgaagaggcacggaaagaaggttatagccattgacctcaaccccctgtcgaggaca
gcaagaatggctgacataaccatcgttgacaacataatcagggcctttccaaaaatggta
gagatggccgaagaaatgaggaagtgggaaagggaaaggctgaaagaagtcgttgaaaat
tacgacaactcaaaggttcttgctgaggccgtggagggaattatccagtatctgcaaaag
gtaaagggagagttgctcagtccctga

DBGET integrated database retrieval system