KEGG   Archaeoglobus fulgidus DSM 4304: AF_1143Help
Entry
AF_1143           CDS       T00011                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase (pgsA-1)
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
afu00564  Glycerophospholipid metabolism
afu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AF_1143
Enzymes [BR:afu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     AF_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf DUF2628
Motif
Other DBs
NCBI-ProteinID: AAB90103
UniProt: O29122
Position
1018437..1018862
Genome map
AA seq 141 aa AA seqDB search
MLTLFISQILDCTDGDLARLTGRVTRSGAYLDRVFDRFVDAAIVIGIVYLYPSELWLAGF
MAVVGSFGVSITRAMAEAEGAECKVGIGGRDTRLAIIMVGLLYGYASGNAVSVYAATLWI
VAVLGFITTLHRMLHTLKQLD
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
gtgctaactctcttcatctcgcaaattcttgactgcactgacggtgacctggcaaggctg
acggggagggttacgaggagcggagcgtacctcgacagagtcttcgacaggttcgtggat
gctgcaattgtcattggaattgtctatctttatccttctgagctatggcttgccggcttt
atggcggtggttggctcctttggagtgagcataacgagggctatggctgaagctgaaggc
gcggaatgcaaagttggaattggtggaagggacacgaggcttgccatcataatggttggg
ctgctctacggatacgccagcggtaatgcggtgagcgtttatgcagcaacgctgtggatt
gtggcggtgctcggctttataaccacactgcaccgcatgcttcacacattaaagcagctc
gactag

DBGET integrated database retrieval system