KEGG   Archaeoglobus fulgidus DSM 4304: AF_1157Help
Entry
AF_1157           CDS       T00011                                 

Definition
(GenBank) phosphoribosylamine--glycine ligase (purD)
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
afu00230  Purine metabolism
afu01100  Metabolic pathways
afu01110  Biosynthesis of secondary metabolites
afu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AF_1157
Enzymes [BR:afu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     AF_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C ATP-grasp_2 ATP-grasp ATP-grasp_3 Dala_Dala_lig_C ATPgrasp_ST DUF448
Motif
Other DBs
NCBI-ProteinID: AAB90089
UniProt: O29108
Position
complement(1033072..1034484)
Genome map
AA seq 470 aa AA seqDB search
MKVLVVDAGGRGNAIAHAFSRSEQVKEIYIAPGNGGSEFFEKCKIAELDGKKIPSIRAID
EIVRFAKKCEVDLAYIGPEEPLSLGLVDRLEEEGIPAVGPKKEATILEASKCWAKDFLKR
IGVPIPEYANFDNPEEAKEYIREKFNNGIVVKADGLAAGKGVYVCDSVEEALRAVDEIMV
QKKFGEAGNRIVVEERLRGIEVAFTAMTDGKTVKPFGHARDYKRAFDSDDIEGLRDFYIG
LTKKFYTKAQIEQLYREGKLINPNTGGMGAVSPHPAVTEEVEQRIMEMVVEPIIENFDKE
FKGVLYPVIMLVEENGELIPKVLEINVRDCDPGAEAKLPRLKSDMAEISMAVVEGRLDEV
EMRFSSDYCVAVCAVSGALKGREGLKPGYPADHYTSQPITGIEEAMKEAIIYANGIAKTN
GYVTTGGRVLTVVGMGQSIEEARSKAYSALEKISFPGMRYRRTIGLDVPE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctggtggtcgatgcaggagggaggggtaacgcaattgctcacgctttctca
aggagtgagcaggttaaagaaatttatatagctcccggaaacgggggtagcgaatttttc
gaaaagtgtaagattgccgagcttgatggaaagaaaattccatctataagggcaatagac
gagatagtgcggttcgcaaagaaatgcgaggttgacctcgcttacatcggaccggaagag
ccgctgagcctcggattggttgacagacttgaggaggagggaatacctgccgtagggccg
aaaaaggaggccacgattcttgaagcaagcaagtgctgggcgaaggatttcttaaagaga
attggagttcccattcctgagtacgcgaacttcgacaatccagaagaggcgaaggagtac
ataagggagaagttcaacaacgggatagtggtgaaggcagatggccttgctgcggggaag
ggtgtttacgtctgcgactccgtagaggaggcattaagggcggtggacgagataatggtt
cagaagaagttcggagaggctggaaacaggattgtggttgaggagaggctgaggggaatt
gaggttgccttcaccgccatgacggacggcaaaaccgtcaagccgttcggccatgcaagg
gactacaagagggctttcgacagcgatgacattgagggcttgagggacttctacatcggc
ctcacaaaaaaattctacaccaaagcccaaatagagcaactctacagggagggaaagctc
atcaaccccaacacaggaggtatgggtgcggtgagcccacatccagcggtaacggaggag
gtagagcagagaatcatggagatggttgtggagccgataatagagaactttgacaaggag
ttcaaaggcgttctttatcctgtcataatgcttgttgaggaaaacggagaactaatccct
aaggttcttgagataaacgtcagggactgcgaccccggagcggaggcaaagctaccgagg
cttaagagcgatatggctgagatatcgatggctgtggtggagggtaggctggatgaggtg
gagatgaggttcagcagcgattactgcgttgctgtttgcgcggtcagcggagctctgaag
ggcagagaagggctgaagcccggctatcctgcagaccactacaccagccagcctataaca
ggaatcgaggaggcgatgaaggaggcgataatctacgccaacggcatcgctaaaacgaat
ggatacgtcacaaccggcggaagagttctgacggtcgttggaatgggacaaagcattgag
gaggcaaggagcaaagcgtattcagcacttgaaaaaattagctttcccggaatgcgatac
agaaggaccatagggcttgatgttcccgagtaa

DBGET integrated database retrieval system